CAZyme Information: MGYG000003522_00393

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UBA7862
• CAZyme ID: MGYG000003522_00393
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178		20607.75	8.172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003522	870958	MAG	Fiji	Oceania

• Gene Location: Start: 120; End: 656 Strand: -

Full Sequence      

MKSKRTFIFFFVAILIVSGVAVFFAVRYPLLYKEEILIYSKNYHLDPALVASLINEESSF
DKNAISSKGAVGLMQLMPQTATYTQQLMGEVAECDLYEPNDNIRIGCYYLSYLYQKFNDQ
TLTLCAYNAGENTVKMWLANENYSQDGKTLNYIPYPQTKTYVDKILYGVRFYRYRLKG

Enzyme Prediction     

No EC number prediction in MGYG000003522_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	46	167	9.6e-28	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.57e-62	29	167	1	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.11e-44	27	175	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.78e-38	47	166	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.14e-29	36	150	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.00e-27	25	176	132	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY84028.1	6.14e-41	1	174	1	177
AQM60520.1	1.74e-40	1	174	1	177
ARC85089.1	2.85e-40	28	173	31	179
ADL52425.1	7.09e-39	2	174	3	180
AYE35401.1	1.16e-38	1	177	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	3.10e-20	27	174	448	600	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	5.74e-20	27	174	448	600	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	6.73e-19	26	178	443	598	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.81e-19	26	178	472	627	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.70e-18	26	178	444	599	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.71e-19	27	174	475	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.71e-19	27	174	475	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.02e-18	27	174	475	627	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	5.01e-12	23	166	419	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	1.08e-11	32	166	1422	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.957414	0.034523	0.002980	0.000301	0.000157	0.004656

TMHMM  Annotations     

start	end
7	29