CAZyme Information: MGYG000003520_01485

Basic Information

• Species: RC9 sp900769145
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769145
• CAZyme ID: MGYG000003520_01485
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		55003.23	4.6414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003520	2768956	MAG	Fiji	Oceania

• Gene Location: Start: 1042; End: 2550 Strand: +

Full Sequence      

MLIALTSAFSCQSKDGPTAPDKVDLSISPETVEASAAEDVYTVIAKCSVKPYIVGQCDWC
AVSASAVKDNSCELTVNVSANDSYQPRSVQFSIVCDEQKKYLKVNQGAAVEDLSFLDNPS
LTDNNALAVSRSLGYGWNLGNQMDAVNNGVSGETFWGNAKCTQETMDGIKAKGFSTVRIP
VTWMGHIGDAPEYAVEAAWLDRVAEIAGYAKSAGLNAIVNIHHDDSPESGWLRVRDAARD
EAFKTEMLARYKAVWKQIAEKFADEGDWLIFEGYNELQDGGWGFGGNLTDGGKQYSVINE
LAQTFVNVVRSTGRNNAGRYLAVLGYSANPALTVNNLTLPEDSAKDRLIVSVHFYDPSGY
ALGQNSAYTEWGHAGTDGKKDPNHGEKNVIDTFKMLKDKYLDKNIPVYIGECGAVNRVDE
RAKAFQQYWFEFVFKAAKEYGLCPVVWDNGAKSTGNESFGFIDHSDGSYINDSKSVIDIM
YKAFSTDTPSYTLKSVYDNSPR

Enzyme Prediction     

No EC number prediction in MGYG000003520_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	153	450	2.8e-92	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.99e-53	144	453	7	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.78e-17	134	456	52	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	2.30e-10	25	106	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	6.68e-05	57	106	9	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60576.1	4.48e-154	2	502	16	512
QUT88430.1	6.76e-148	18	502	121	598
QRX62664.1	1.06e-144	3	502	16	513
AVM57519.1	2.11e-143	1	502	60	563
AIF26005.1	2.06e-140	112	502	16	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	7.30e-130	120	486	18	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	8.73e-116	123	501	4	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	6.98e-115	123	501	4	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	1.26e-71	126	465	35	377	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6WQP_A	1.48e-57	113	463	2	337	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	8.67e-65	114	450	31	369	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P23660	2.45e-59	123	473	24	354	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	1.84e-54	136	465	53	355	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
Q12647	4.03e-54	113	465	12	346	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	7.34e-54	129	463	45	355	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.320114	0.247942	0.431315	0.000273	0.000178	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003520_01485.