CAZyme Information: MGYG000003514_00744

Basic Information

• Species: Fibrobacter_A intestinalis
• Lineage: Bacteria; Fibrobacterota; Fibrobacteria; Fibrobacterales; Fibrobacteraceae; Fibrobacter_A; Fibrobacter_A intestinalis
• CAZyme ID: MGYG000003514_00744
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		53829.67	4.9054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003514	2933446	MAG	Fiji	Oceania

• Gene Location: Start: 44095; End: 45579 Strand: -

Full Sequence      

MKLDFSSGFLSAVCTILGAVSFLTAAPDPNFHIYIAYGQSNMAGAGEIRKGIDDVEHPRY
KMYATTACTQLGRPNVGALYPAIPPMFHCGEGLSIADWFGRYMADSLPEVTVAVIPVAVG
GTKIELFDKDKYAEYLAGEASWLVNWAKDYGTDGNAHARIVEVAQEAMKEGVIKGFIFHQ
GESGAMSGNDWQSEVKKTRDDILNALNLSADTIPFLAGEMEDSDAGGCCYGFALNQVGNL
PNIMENTYVVKSTGLKGNGKDSYHFSSESYQEFGLRYAQKMLEVMHKTAAVVPQEPFGGK
RVTLPGRIEAENYDLGGQNKAYYDSDLKNEGGKYRDDGVDIDTIPAGGYAVGYTRKGEWL
KYSVEAPLAGDFEVSVHVATGSTAAGIAVFVDERILGDSVPVEKTGEDWSSYQMVSVGKL
TLPAGNHEIKLLVTGDYVNIDYLDFSLCADSTTAIRSGRQIHEQAKDKRLRFDGQKVYLQ
KNGKKFDLLGIQIK

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	310	446	5.4e-27	0.9855072463768116
CE6	95	206	7.7e-24	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	8.85e-51	304	446	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam03629	SASA	4.19e-32	30	283	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
smart00606	CBD_IV	2.09e-18	301	445	1	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	2.05e-15	336	446	8	124	Carbohydrate binding module (family 6).
cd04079	CBM6_agarase-like	4.30e-15	307	447	5	134	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL25665.1	4.93e-151	7	456	6	460
ACX76120.1	5.26e-151	7	456	8	462
ADU86917.1	1.65e-137	19	446	24	458
ACX75359.1	4.51e-137	19	446	24	457
ADL25018.1	4.51e-137	19	446	24	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8K_A	2.83e-13	307	446	342	481	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5LA0_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20],5LA1_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20]
5LA2_A	2.83e-13	307	446	342	481	ChainA, Carbohydrate binding family 6 [Acetivibrio thermocellus],5LA2_B Chain B, Carbohydrate binding family 6 [Acetivibrio thermocellus]
5G56_A	3.31e-13	307	452	340	485	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	5.55e-39	27	309	42	311	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000652	0.998606	0.000184	0.000178	0.000172	0.000175

TMHMM  Annotations     

start	end
5	27