CAZyme Information: MGYG000003512_01646

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_01646
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000003512_74|CGC1	34675.2	5.2052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 2075; End: 3022 Strand: +

Full Sequence      

MLTLFLHPGESLQAAIDSLPQDGSPALIRLVPGEYREKVELRRPHTILMGSGADKTRLVW
DDAAAALHPDGRKYGTFRSYTLLVLAEDCRVKNLTVCNEAGSRDGAGQCIALFADGDGFV
CENCELISCQDTLFTAPLPPQEALPGGFIGPTQFLPRTPQRQTYLRCVIRGDVDFIFGGA
AAWFEDCEIICVNRHISGRAPGGYATAASTPEGQKYGYVFRYCWFTGEDVPDASFCLGRP
WRAYAKTVLLDCYIGAHIRPEGWDNWGKADFARTGCYAEYACFGPGSASEHRAFSRQLTK
EEAAAITYEDFLHSL

Enzyme Prediction     

No EC number prediction in MGYG000003512_01646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	11	313	7.7e-78	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.00e-60	11	286	96	378	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	1.95e-48	11	312	19	296	pectinesterase
PLN02432	PLN02432	1.87e-47	12	312	26	286	putative pectinesterase
PLN02682	PLN02682	5.45e-46	11	303	84	352	pectinesterase family protein
pfam01095	Pectinesterase	8.00e-44	11	312	14	295	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX89293.1	3.36e-88	10	312	28	340
QJU20267.1	1.26e-87	10	293	29	309
ANU50094.1	2.70e-87	10	288	28	303
QQR01004.1	2.70e-87	10	288	28	303
QRP39805.1	3.94e-87	10	287	29	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	1.67e-30	10	307	45	353	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	1.33e-24	10	292	16	274	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.94e-24	10	312	19	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	5.84e-21	10	292	20	278	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	4.79e-18	15	299	25	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.83e-43	11	312	19	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	2.66e-35	10	314	302	594	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9ZQA3	9.68e-35	1	312	90	379	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q9SIJ9	3.67e-34	10	312	62	326	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9LXD9	2.44e-31	10	314	252	543	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_01646.