CAZyme Information: MGYG000003512_00531

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_00531
• CAZy Family: CBM50
• CAZyme Description: Elongation factor 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978		105307.87	7.313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 18089; End: 21025 Strand: -

Full Sequence      

MTKVKLKDATRELLADATKVKEQASRARKGAENLLQSLRALENGFVKANEEKDAELKRAE
AEKQRADQSKAYVMLDADERAALDAAEKEAERAKAEKAAAKAAAEKAAAEKAAAEKAAAE
KAAAEKAAAEKAAAEKAAADKAAEEKAAAEKAAAEKAAAEKAAAEKAKAEAPKKPAIGQI
ISRPGQAVPQKPVGLAPNVIRPPRPQQPRPAQAAPVQQGPRPQGAQGRPANGTFQPRPQG
QGFQPRPANGTFQPRPQGAPCQQAARPQGQGRPANGTFQPRPQGQGFQGRPQQGGFQPRP
QAAPGQGRPMGGGMNRPKPAAPDMTPSMGKERVSNYDPNKKNYVRQHDPEHVARNRKQLS
RDAGYSGYDDDVIRGGKKSRKKPSAQQMMAPIKIETAYMSGDTIIVRDLCEKIGKPSGEI
IKKLFLLGNMATINSEIDFDTASLVCADFEITLEKKAEQTAEDQLIAEDFEDTDENLMSR
PPVVTIMGHVDHGKTSLLDYIRKSRVTAGEAGGITQHIGAYTVTVDGDRQITFLDTPGHE
AFTAMRARGTQATDIAVLVVAADDSVMPQTVESINHAKAAEVPLIVAVTKMDKPEANPER
VKQDLTNYGIVCEDWGGDTIVVPVSAVTGEGIDELLEMILLQAETMELRANPNRLGRGVI
VEAKLDKARGPLATVLLQNGTLRVGDNIVAGMASGRVRALINDKGEKVKEAGPSMPVEIM
GFDEVPSAGDEMIAVGDDHLSRQVAEERKAKVKASREASMAKMSMENLFSNLEAGKQTTL
NLIIKADVQGSVEAVKQAMEKLSNDEVRVRVLHSAAGAITKDDVNLASAFNAIIIGFNIR
PDASARETAEREKVDVRLYTVIYKAIEDMELAMKGLLAPEFKEVILGHAEVRAVMKITGA
GIIAGSYVLDGKMQRNAQVRLLRDNVVVHEGKLSSLKHFKEDVKEMKEGFECGMSLEGHN
DIKEGDIIECFIMEEIPR

Enzyme Prediction     

No EC number prediction in MGYG000003512_00531.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05306	infB	0.0	253	978	45	745	translation initiation factor IF-2; Validated
CHL00189	infB	0.0	376	978	136	740	translation initiation factor 2; Provisional
TIGR00487	IF-2	0.0	399	978	7	584	translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU. [Protein synthesis, Translation factors]
COG0532	InfB	0.0	480	978	4	505	Translation initiation factor IF-2, a GTPase [Translation, ribosomal structure and biogenesis].
cd01887	IF2_eIF5B	5.70e-105	482	646	1	169	Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family. IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGL64345.2	7.69e-191	407	977	286	856
CAE6204650.1	1.12e-10	485	696	751	977

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JCJ_f	1.59e-197	372	978	281	887	Structuresof ribosome-bound initiation factor 2 reveal the mechanism of subunit association [Escherichia coli],3JCN_b Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association: Initiation Complex I [Escherichia coli],5ME0_W Chain W, Translation initiation factor IF-2 [Escherichia coli K-12],5ME1_W Structure of the 30S Pre-Initiation Complex 2 (30S IC-2) Stalled by GE81112 [Escherichia coli K-12]
6O7K_f	1.19e-187	480	978	9	506	30Sinitiation complex [Escherichia coli],6O9K_z 70S initiation complex [Escherichia coli]
1ZO1_I	3.58e-187	480	978	3	500	IF2,IF1, and tRNA fitted to cryo-EM data OF E. COLI 70S initiation complex [Escherichia coli]
5LMV_a	1.02e-156	406	977	6	570	Structureof bacterial 30S-IF1-IF2-IF3-mRNA-tRNA translation pre-initiation complex(state-III) [Thermus thermophilus HB8]
3J4J_A	4.55e-154	406	976	6	569	Modelof full-length T. thermophilus Translation Initiation Factor 2 refined against its cryo-EM density from a 30S Initiation Complex map [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5N842	7.49e-239	402	978	116	691	Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=infB PE=3 SV=1
B8I6E7	2.43e-237	368	978	551	1161	Translation initiation factor IF-2 OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=infB PE=3 SV=1
A4XL70	1.84e-236	373	976	246	856	Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) OX=351627 GN=infB PE=3 SV=1
C3L0B6	2.06e-231	377	978	82	685	Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) OX=515621 GN=infB PE=3 SV=1
A7FVZ3	2.91e-231	377	978	82	685	Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=infB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_00531.