CAZyme Information: MGYG000003511_00570

Basic Information

• Species: SFVR01 sp900769035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; SFVR01; SFVR01 sp900769035
• CAZyme ID: MGYG000003511_00570
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000003511_108|CGC1	44730.44	9.292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003511	2091537	MAG	Fiji	Oceania

• Gene Location: Start: 7535; End: 8698 Strand: +

Full Sequence      

MLETLYITIEYILLAFLSVTFIIQIYFYIHPYSSIIRKNKKEKKLGICNNDIQPSVSVII
CAKNEAENLQSFLPLILEQEYPNYEVIVVNDGSFDNTSHVLKEMQSKYKELYVTGIPEDV
NIISRKKLALTVGIKAAKNDILLLTDADCRPHSKHWISTMVRNFNAHTEFVLGFGDYLQE
KSFVNKLICYDTLFIAMQYLGFACIGKPYMGVGRNIAYRRETFFNNNGFAGFLQISSGDD
DLFVNHHANKSNTKVEINLLSKTLSIPKHTFKDWFHQKARHLSSSKLYTNKSKYLIMIEP
LTRGLFYLTLILLLCLYSSNIIVVSACLGMFFIRYITQLLVYNLTSKAITGRKLYLSILL
FDILLPIINLYIITIHNKIHKRVEYTW

Enzyme Prediction     

No EC number prediction in MGYG000003511_00570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	57	180	1.4e-20	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	3.36e-59	58	283	1	228	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	4.75e-22	1	379	5	381	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.53e-21	58	230	1	173	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	6.32e-21	15	164	19	159	N-glycosyltransferase; Provisional
cd00761	Glyco_tranf_GTA_type	1.96e-19	58	250	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ81104.1	5.58e-120	9	387	11	387
QDH56872.1	4.16e-96	8	370	8	373
QUT30041.1	5.88e-96	8	370	8	373
CBK69358.1	5.88e-96	8	370	8	373
QRN00946.1	5.88e-96	8	370	8	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	1.03e-06	56	195	25	163	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
6P61_A	2.81e-06	54	189	13	145	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYG7	1.63e-10	54	185	6	144	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
Q8XAR5	9.49e-10	54	187	75	205	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	9.49e-10	54	187	75	205	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8GLC5	1.17e-09	38	148	29	136	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	4.93e-09	56	148	49	136	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
311	333
354	376