CAZyme Information: MGYG000003505_01583

Basic Information

• Species: CAG-977 sp900768845
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; CAG-977; CAG-977 sp900768845
• CAZyme ID: MGYG000003505_01583
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		34409.43	5.9461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003505	2316811	MAG	Fiji	Oceania

• Gene Location: Start: 22602; End: 23543 Strand: +

Full Sequence      

MNVEKYMQKTIKHEISCVGTGLHTGNKISMTLKPAEPNTGIVFHRTDIAGQDAYIPALHD
YVIDTRMCTCIGNKDGVRVATIEHLMAAIHAMGVNNLLIDINGPETPVMDGSSAPFVFLL
ECAGIKVQRAPVKAIRILKPVSFKDGDKEVTLRPTDGEGLNMHFEIDFDAPVIGHQEADL
TLSASNFKNSFCRARTFGFLKDIEMLRSIGLARGGSLDNAILVNDNMIMNKDGLRYKNEF
ARHKMLDAVGDLYMSGYTFVADFCGKRSGHTQTNALLSAMFADPSCYEIVDLMTTGSDHE
EAPSVEDLRRDCA

Enzyme Prediction     

No EC number prediction in MGYG000003505_01583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	8	281	1e-105	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	1.57e-163	7	305	3	292	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
pfam03331	LpxC	5.17e-153	8	282	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
COG0774	LpxC	2.51e-141	7	304	3	299	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	3.40e-110	7	303	2	290	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	5.66e-86	7	280	4	298	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ72797.1	7.72e-114	7	292	5	288
ARJ68190.1	2.56e-107	8	292	3	287
CUW38573.1	2.66e-104	8	292	23	307
ASG21128.1	6.26e-103	8	293	13	301
AEP10200.1	4.16e-102	7	292	1	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDT_A	3.11e-86	8	303	4	294	Structureof LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_B Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_C Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_D Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli]
3P3G_A	3.75e-86	8	303	4	294	CrystalStructure of the Escherichia coli LpxC/LPC-009 complex [Escherichia coli IHE3034],3PS1_A Crystal structure of the Escherichia Coli LPXC/LPC-011 complex [Escherichia coli IHE3034],3PS2_A Crystal structure of the Escherichia Coli LPXC/LPC-012 complex [Escherichia coli IHE3034],3PS3_A Crystal structure of the Escherichia Coli LPXC/LPC-053 complex [Escherichia coli IHE3034],4IS9_A Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4IS9_B Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4ISA_A Crystal Structure of the Escherichia coli LpxC/BB-78485 complex [Escherichia coli IHE3034]
4MQY_A	4.40e-86	8	303	4	294	CrystalStructure of the Escherichia coli LpxC/LPC-138 complex [Escherichia coli]
3NZK_A	7.54e-86	8	303	9	299	Structureof LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica],3NZK_B Structure of LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica]
2VES_A	2.07e-85	8	290	4	284	CrystalStructure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W0G6	1.03e-102	8	292	3	287	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxC PE=3 SV=2
B0US73	1.10e-96	8	303	4	294	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Histophilus somni (strain 2336) OX=228400 GN=lpxC PE=3 SV=1
Q0I1C7	2.21e-96	8	303	4	294	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=lpxC PE=3 SV=1
Q4QLF2	2.54e-95	8	303	4	294	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=lpxC PE=3 SV=1
B5ELD7	1.99e-94	8	291	4	285	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31) OX=380394 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003505_01583.