CAZyme Information: MGYG000003493_02457

Basic Information

• Species: Prevotella sp002299275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002299275
• CAZyme ID: MGYG000003493_02457
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		48371.58	5.7066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003493	3028354	MAG	Fiji	Oceania

• Gene Location: Start: 11879; End: 13147 Strand: -

Full Sequence      

MKYNYFKGFMTLVTTCMMTFTTTAHAQKYVGGDISALPTNEQKSPTYYDKHGNTVSDPLD
IFKSEEMNAMRVRLFVKPTDYPNNDPFACQDLDYVKSLGKRIKDAGFKLMLDFHYSDTWA
DPAKQWTPKAWENLTDEELYQKIYEYTKDALLQLKSAGAEPDFIQTGNEISYGMLWGKEG
SNNLKKCFMGSTANWSRFTTLLSEAGKACREVCPNAKIVLHTERAAQTNVLTNFYDKMKD
ANIDYDIIGLSYYPIWHNNIATLETAINTLETRYTDKDIMIVEVGAAYSWLPGDKDYTPD
YATTENGQKQFTDDLIAMLNKHNKVTGLFWWWMDYNAYPWDTTRMDDWWYAPLIDSNTGK
PLAAMSSLKNFLDGSTDIRHSIVDKIDDNGQWFTVSGQPAGQNPTKPGLYVRNGKKKIVE
RR

Enzyme Prediction     

No EC number prediction in MGYG000003493_02457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	30	365	4.7e-91	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.25e-86	29	366	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	2.73e-74	31	365	42	388	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	3.13e-153	21	422	17	417
QVJ80245.1	9.08e-124	21	422	17	424
VEH14955.1	9.63e-120	28	373	47	399
QUT66820.1	1.55e-94	25	372	20	364
AGB28452.1	6.98e-92	24	372	18	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.59e-57	31	371	53	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	3.33e-39	31	331	27	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	2.38e-38	31	331	27	320	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	1.63e-36	26	331	1	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	6.02e-35	26	331	1	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	3.79e-54	30	377	8	355	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P48841	4.23e-41	29	330	28	325	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
O07013	2.32e-39	31	331	56	349	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q65CX5	2.89e-38	31	331	52	345	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
A1D3T4	3.98e-37	29	331	25	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000770	0.990381	0.008148	0.000249	0.000220	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003493_02457.