CAZyme Information: MGYG000003490_00487

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000003490_00487
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45649.85	4.7694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003490	2488924	MAG	Fiji	Oceania

• Gene Location: Start: 36; End: 1220 Strand: +

Full Sequence      

MIVCDFFHWPRMGDYRFDPDFFPDPAAMVRELKAMGIELMVSVWPQIALTSENYEEMLQQ
GLLVRAEYGEQVGMRFVEDSMFFDATNPRARSYVWEKCRKNYFDQGIRLFWLDEAEPEYG
TYDFKAYRYQQGSSQQVGNIYPQQYVRGFCEGLQAQGVEQPLSLVRCAWAGSQRYGALVW
SGDIMSSWEDFRKQVCAGLSMGFAGIPWWTTDIGGFHDGWPAHEDFRELLIRWFQWGCYC
PVMRLHGDRKPVEPVYRPDGTRVLNSGSDNEVWSYGEEAYPILVKYMRRREDMRPYVREM
MRQAHEAGKPLLRAMFYEFPDDPACLNLKDQYMFGSDYLVAPILGPGLRSRDVVLPAGAR
WENVDTGEAFPGGQTVTAPAPLDVIPVFRRVQEP

Enzyme Prediction     

No EC number prediction in MGYG000003490_00487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	2	390	3.7e-119	0.8407494145199064

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06591	GH31_xylosidase_XylS	1.18e-137	1	290	42	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	8.17e-127	2	390	299	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	9.49e-119	2	388	62	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	6.62e-65	17	390	58	421	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06598	GH31_transferase_CtsZ	3.55e-56	11	265	60	312	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ39557.1	6.23e-200	1	390	265	654
AQR96534.1	2.52e-185	1	390	269	659
AGF57858.1	8.22e-184	1	390	269	659
ASU29332.1	5.48e-183	1	390	265	655
QJU13258.1	5.48e-183	1	390	265	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMP_A	1.34e-72	2	390	470	860	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	2.02e-69	2	390	467	869	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6DRU_A	2.18e-68	1	389	281	705	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
5JOU_A	5.21e-62	2	390	439	839	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
5F7S_A	1.68e-48	10	391	348	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	2.86e-105	1	251	277	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	1.98e-69	1	390	253	617	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	1.59e-67	1	389	299	723	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
A7LXT0	2.83e-61	2	390	438	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9F234	8.14e-46	12	390	301	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003490_00487.