CAZyme Information: MGYG000003488_00109

Basic Information

• Species: CAG-488 sp900554995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp900554995
• CAZyme ID: MGYG000003488_00109
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000003488_4|CGC3	35206.45	7.9114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003488	2291044	MAG	Fiji	Oceania

• Gene Location: Start: 86502; End: 87410 Strand: -

Full Sequence      

MDCLVSVIIPTYKRKLNFVSNALQSVLDQTYKNIEIIVIDDSPSDFPFRDDIKNYIAELK
NDKVIYIRNEKNLGGSLSRNVGISAAHGEYITFLDDDDEYMPGKVEKQLNFMLETGCDLS
FSDMIMYRLDGKVCDFRDHKGIMAYDNDTLLRYHLTRNLSGTPSFMFKADKLREIGGFRD
AKMGQDFFLMLNAIESGLKIRYFNSCDVKVYKHNDGGISQGRNKIDGENMLYDFKKQYFD
RLSKNEIRYVDFRHRMVMSIAYKRNHLYGKMLCCMAHAFVTSPNYFITECISFIKNLVTY
RH

Enzyme Prediction     

No EC number prediction in MGYG000003488_00109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	124	7.5e-31	0.6764705882352942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.21e-29	6	119	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	2.78e-29	4	202	2	192	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	4.92e-28	7	160	1	154	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10018	PRK10018	1.52e-21	4	265	6	268	colanic acid biosynthesis glycosyltransferase WcaA.
cd06433	GT_2_WfgS_like	1.91e-20	6	219	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY39829.1	3.78e-91	1	297	1	297
ATH85494.1	1.77e-87	4	297	9	300
ATF26155.1	1.77e-87	4	297	9	300
SPN70800.1	1.43e-86	4	297	9	300
AWG44220.1	9.81e-81	1	302	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	8.25e-14	4	231	6	235	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	2.48e-10	5	124	7	121	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
1H7L_A	1.57e-07	5	109	3	110	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58457	1.67e-20	4	199	9	200	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
O32268	4.44e-20	4	206	7	199	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q92IF9	1.35e-18	2	144	292	427	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q4UM29	3.31e-18	2	115	292	399	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q1RIM7	8.71e-18	2	130	290	410	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003488_00109.