CAZyme Information: MGYG000003483_01893

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_01893
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914		99826.93	7.3746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 2662; End: 5406 Strand: +

Full Sequence      

MIMKRLMAAGALTGACLCAHAEILSLAGEWRFALGETNALSDTIRLPTTTDLARKGDGRL
GGAVVERIHPQLLGAEMAGALTMHPARRFPFVGVARYARDVEVPASWEGKRVSLFLERTK
IVRAFWDGADLGRRDTLAAPAVFELPPDVRPGRHTLRLEIDNRLDDLPVSGHQVSDDTQT
NWNGVMGRIELRAEGPTRFGRIRLFPDPAARTVGVEAEVISPTGVTTSRQTVALAKDAAL
WSEFTPVLHEVEVRVGGLSRTMKVGLRSFGTRGTQFTVNGRPTFLRGRHDACVWPLTGAA
PMDVGTWRKYFRTLKDYGLNHVRFHSWCPPEAAFEAADELGFYLQPEFACFGGDWSRPEQ
RDYCLAESKRILDAYGNHPSFVMFSLANEPLKGREGRLAVVEALRAHDPRPLYAQGTNAD
FFVPKACPGDDFWATFRSAPGAEGNVRGSYANADLPLGGVQEPGGGTTRDFASAIAHSPV
PLVGHEVGQYQVYPDYSEIAKWTGPLKPVNLEIFRERLRKAGLIDKADAFFRASGALAVL
NYREDIEEALRTPGFGGFQLLDIQDFPGQGTALVGILDAFMEPKGLIAPEAWRGFCAPTV
LLVRFPSYTHEAGAVFAAELLVAHYGAEDVLDATLAWRLVEAGRGPEDGRLAPSARDGKV
VESGSVPLKVAVGNVAKVGEIRAVLPNCARPARYALELALAGRAEWNAYPLWVYPRAEAT
VPDGVAVVTSLDEGERLLAEGRNVLCLLSKANAPTNAVAGTFASDFWNWQMFRHVCESNR
KPVAPGTLGLLVDAAHPALAGFPTACHSDFQWRELLFRGVNVVLDGDPDAEVIVQGIDNV
TRNHRLGVIWEKRCGTGHLVVSALDLDACAHLPEARALRRSLLDYLAKGARPPARFRPVP
RLNRVNMVYSRPCK

Enzyme Prediction     

No EC number prediction in MGYG000003483_01893.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	428	6.1e-58	0.488031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.93e-19	236	595	248	629	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.17e-13	272	433	4	180	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	8.00e-10	22	412	11	445	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.21e-08	263	409	314	468	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00219.1	2.54e-224	24	887	6	892
AGI38265.1	2.54e-224	24	887	6	892
ANW97658.1	2.54e-224	24	887	6	892
AGC67186.1	2.54e-224	24	887	6	892
QCD36762.1	1.76e-217	19	890	27	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.49e-14	97	418	114	470	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.49e-14	97	418	113	469	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	2.18e-13	241	416	263	447	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	2.20e-13	241	416	284	468	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
6ZJP_A	2.20e-13	241	416	284	468	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	8.14e-14	97	418	114	470	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q59140	2.43e-11	21	416	27	461	Beta-galactosidase OS=Arthrobacter sp. (strain B7) OX=86041 GN=lacZ PE=1 SV=1
A0KQH4	1.31e-06	26	420	49	493	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1
A1A3T0	5.13e-06	239	417	313	511	Beta-galactosidase BgaC OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=bgaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001051	0.837605	0.160226	0.000363	0.000400	0.000336

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_01893.