CAZyme Information: MGYG000003483_00555

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_00555
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		85777.79	6.8529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 34235; End: 36574 Strand: +

Full Sequence      

MKTRLCMMLAAAAALACGAYTPAPGMKTPWGEKITPENAWREYPRPQMVRAAWTNLNGLW
QYAVTKDAPGIPAKWDGEILVPFVIESSLSGVGRLLEPSETLWYRRSFNADAKPGERVLL
HFEQADFRAQVFVNRVEVGVPHEGGQMPFTFDVTDYVKPGANELVVAVWDPTTGFIGSVG
KQVFKPHGCMYTRSSGIGGTVWLETVPETHLVDYTVTTDIEAGTVSVTLVGAGNLTKAEG
RVEVRRGGKTLASGALAAWGKPITIKLPQPVALWSPESPALYDLAITFRDGATGSEDVVR
GYFGMRAFEMKKDANGVLRFYLNNKMRFIVGTLDQGWWPDGLLTPPSEEAMAFDILQLKK
MGFDMMRKHIKVEPRRYYHLCDTLGLLVLQDMPSGGGSAEARYGFYRRELKEMVDHLQKT
PSIVMWVPYNEGWGQPGEFLTHATLMWTQRYDPTRLVDGPSGWCDYEGGDRGWKAELRGG
SAHKPLGEEEAAHAIDKHDYGARPQMFPVNPRRASFLGEFGGIGCRVADHLWTTNAWGYG
GTGNDADRAAVQAKFVALMEHVGNLARRGLAGCVYTQTTDVEAEINGLITYDRKVVKFDP
AALAAVHDRVRAKAALGLVPTVAKEVFPKRDPNPRAWAYTFDAPAADWFRPAFDDAAWKR
SAGGFGGGGIEKAHAAAKVATPWTTKTLWVRRHFAWDDAPAKIVEAVVEMFHDEDAEVYL
NGERILAVTGYTTDYVPFGIDAEAFAKAVRKGDNVLAVKVVQTVGGQFFDLGLSVEVAR

Enzyme Prediction     

No EC number prediction in MGYG000003483_00555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	459	3.1e-96	0.48936170212765956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.66e-40	39	457	1	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	9.11e-24	41	471	35	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	5.04e-20	55	486	14	504	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.02e-19	147	469	168	490	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.77e-12	56	207	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTS09269.1	1.09e-215	20	773	22	748
AWM37302.1	1.09e-215	20	773	22	748
QJW99401.1	1.63e-209	6	779	7	754
VTR93844.1	2.67e-206	6	773	8	745
AMV27317.1	3.77e-206	6	774	8	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.23e-143	26	610	12	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6D8K_A	7.98e-20	101	456	99	439	Bacteroidesmultiple species beta-glucuronidase [Bacteroides ovatus],6D8K_B Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_C Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_D Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus]
5EUV_A	2.08e-17	56	459	7	391	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d],5EUV_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d],5LDR_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d]
5LDR_A	2.09e-17	56	459	8	392	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d]
3GM8_A	6.82e-17	98	457	64	421	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	4.99e-20	103	426	59	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.59e-20	103	436	106	435	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	7.98e-19	54	500	49	502	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q47077	5.79e-16	36	469	34	491	Beta-galactosidase OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
P06760	1.60e-15	56	457	41	475	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000370	0.017422	0.982181	0.000022	0.000031	0.000022

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_00555.