CAZyme Information: MGYG000003480_01268

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000003480_01268
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000003480_102|CGC1	35565.23	10.135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003480	2592239	MAG	Fiji	Oceania

• Gene Location: Start: 6332; End: 7261 Strand: -

Full Sequence      

MNKRTNSVVLALVCLLFSIQGASAQMKWNSAYQSYIDQYKDLAIEQMLRYNIPASITLAQ
GLFESAAGRSNLTRSGNNHFGIKCHGWTGKRTYHDDDAAGECFRAYDNARQSYEDHSRFL
ATQSRYARLFSLKRTDYRGWARGLKQCGYATNPQYASKLTQIIELYGLNKYDRATTYDRF
IAKHASEESPGPDGVRYVIKAYNDNYYVIAKKGETFKSLGKELGISGRKLAKYNERDKRE
TLDDGDVIYLKKKRNNAERNFKNRPHTVKAGESMYSIAQKYGIRLKSLYKKNRLSPDYNI
RVGDKLRVY

Enzyme Prediction     

No EC number prediction in MGYG000003480_01268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	168	4.7e-32	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	8.99e-36	33	172	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.83e-31	20	177	31	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.33e-26	25	172	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.54e-23	40	168	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12711	flgJ	1.98e-19	58	162	241	354	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29226.1	8.59e-146	10	309	11	308
ALO49150.1	2.56e-144	7	309	5	305
BCS86660.1	1.15e-143	24	309	2	288
QNT66218.1	1.84e-142	4	308	5	306
VEH15664.1	1.37e-139	12	309	8	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.53e-12	33	163	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.02e-12	33	163	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.00e-11	33	163	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	7.82e-08	33	172	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.97e-06	51	205	79	232	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	9.98e-14	54	308	202	472	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	1.27e-10	33	162	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
O32083	1.90e-10	33	186	49	212	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999206	0.000153	0.000161	0.000141	0.000131

TMHMM  Annotations     

start	end
7	24