CAZyme Information: MGYG000003479_00753

Basic Information

• Species: CAG-312 sp900548275
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900548275
• CAZyme ID: MGYG000003479_00753
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000003479_30|CGC1	59642.42	7.8571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003479	2365803	MAG	Fiji	Oceania

• Gene Location: Start: 6668; End: 8266 Strand: -

Full Sequence      

MTLKHTIKKGVGIAIFAFAASSLFALDVKIDAAKTHQTIDNFAAADAWSGYFVGQYFDEA
QKGQLAKWLFSQKIGADGNPEGIGLSMWRFNLGGGTLEQDGANIVPFQRRAESFLTKDGK
SYDWGKCAGQMYFVKKAKEYGVEKLLLFSNTPPVQWTRNGQGYGEKRDNKANIKPECYGK
FADYMADVAKKFGEMGYKVDYISPINEPQVNWDSNRQEGSPWYISEMKRVFVELDRALTE
RNLDTQIYIGETAHPKYNYAGAAWSAEPARWAKDPVAERPTFIIKNFFDKNSPAYVGDLK
HMPKFLSGHSYHSHLRNADMENVHKTIAAEAAKYGVQYQQSEWCLLPHYKAAEMDGFTKD
WYSDNKADIQTALLMARIMYSDFVNSQATAWGYWKGMEIKGDHALTGVYPANGRIEDGGV
ARANKLLWAMGNFSLFVRPEFKRVEMSGADNLDKTAGVAFVSPDAKRLVAVFVNSSFERD
VAKISLSESFANAKARAFRTDANTDLGNAWIDEASREIVLAPRSITTVVFDL

Enzyme Prediction     

No EC number prediction in MGYG000003479_00753.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	27	529	1.4e-146	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.85e-101	28	394	4	353	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.50e-12	17	532	24	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84534.1	1.35e-113	14	532	13	530
ALJ59966.1	7.41e-113	28	532	42	534
QUT89021.1	7.41e-113	28	532	42	534
QIK59847.1	3.27e-111	27	532	40	534
QIK54438.1	3.27e-111	27	532	40	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	6.43e-64	30	531	10	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	3.48e-10	17	502	12	422	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	8.04e-10	350	529	271	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.14e-09	351	529	279	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	4.66e-09	350	529	295	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001539	0.997464	0.000246	0.000260	0.000234	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003479_00753.