CAZyme Information: MGYG000003477_00204

Basic Information

• Species: Acidaminococcus timonensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus timonensis
• CAZyme ID: MGYG000003477_00204
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42425.14	6.1153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003477	1890782	MAG	Fiji	Oceania

• Gene Location: Start: 7488; End: 8636 Strand: +

Full Sequence      

MKLSRLLCLGLCLLALTGTACAKKPTAPDTKKNGPVTAYMPRKLEGPVHLVWDWQAPGEA
SSKLAQEKKLPGINVLSPSWFILSDTEGNIEVKNATTDYAPQAHDKGYKVWALITNGFDP
DRTHGLLDNPVGRQKAAENLLQLARTYQLDGINLDFENIKPEDSDRLTAFVGELSGVLKP
AGYTVSIDVTVPSDNGNWSKCYNRKELAEQVDYVMLMAYDEHHRLSNVAGSVASLPWVEQ
GIQKTLLEVPKEKLVLGMPLYMRDWTVKEDGTVSARTLSMPGARKRIRDHNLVPVWLSSE
GQYYFEYKEQGTLHKVWMEEGRSLALKNALISRYDLAGSAYWRKGLEEPEVWENAEAYTA
GAGYADAPPENGPADAHRPSNP

Enzyme Prediction     

No EC number prediction in MGYG000003477_00204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	91	345	1.3e-40	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.89e-95	56	353	9	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.24e-58	73	352	127	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.15e-35	56	352	7	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02875	GH18_chitobiase	3.93e-28	103	342	73	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
smart00636	Glyco_18	2.64e-27	81	342	33	329	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB47041.1	1.73e-186	10	358	10	360
BBB92123.1	4.89e-98	26	353	147	471
QJW48079.1	1.12e-95	22	352	135	471
QIB60827.1	2.42e-94	54	352	42	339
BDA10778.1	7.76e-93	54	352	42	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	8.01e-34	113	348	76	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	5.56e-25	114	352	176	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	1.68e-21	110	352	173	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
5JH8_A	1.30e-19	133	352	89	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	7.45e-18	52	345	10	330	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	2.69e-32	113	343	168	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	1.38e-31	58	353	37	337	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	2.17e-24	114	352	175	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.02e-23	114	352	175	417	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	1.66e-22	113	352	169	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000348	0.300510	0.698686	0.000182	0.000148	0.000119

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003477_00204.