CAZyme Information: MGYG000003475_00120

Basic Information

• Species: Selenomonas_A sp900769615
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A; Selenomonas_A sp900769615
• CAZyme ID: MGYG000003475_00120
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000003475_1|CGC2	55528.52	8.0926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003475	2184431	MAG	Fiji	Oceania

• Gene Location: Start: 87556; End: 89004 Strand: -

Full Sequence      

MSLNRKFLWGILICSILIYFVGNNFLVVTDPVESNYTETALEMLQSGDYFSPRIYGNYWY
DKPIMFYWELIAAFKMFGVNDFAVRFFPALFATIGIFMTYFWGRHLYSEKHGLVAAFILG
TSVECWYIGHAVITDMTLFVTLSGTLMAFYEGYSQKKPCYFYLAFVLAAIAVLTKGPIGL
CLPGLIILIFLGIKRQLKVLVSYHILLGAMLFFIISGIWYYPMYLMHGMDFIDTFLGVHN
ALRATVSEHPRDNVWYFYLLVYLAGLLPWSIISLPAIIRRLWRRDVHWPQNEITLFLLVW
AITVFGVFQLFATKYVTYTLPYMVPAALLLARYFVKHMEIFRFATIFMTVFYLAAVFFIA
PPLMEKNSGKDMAAYLKTVIHDDDIVLSYDKTYSASLVYYSGIEVKKLATAETIAKERPA
GISWNSTNVMPFMAIEDIKDTDKLLVVTNEKDYVKLQQELPGNWHEAGRINGQMLVRRSV
GE

Enzyme Prediction     

No EC number prediction in MGYG000003475_00120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	361	2.7e-95	0.6574074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.77e-48	5	360	7	362	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.55e-30	5	366	5	373	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.22e-15	61	219	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.38e-07	8	232	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam10131	PTPS_related	2.70e-04	57	278	2	233	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO74995.1	6.36e-146	11	464	31	494
CCC74317.1	6.36e-146	11	464	31	494
AXL22207.1	4.84e-145	11	469	36	514
AVO27725.1	2.06e-144	11	464	31	494
ALG42265.1	4.81e-143	20	464	30	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.18e-21	9	331	33	360	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	4.12e-34	5	321	3	308	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q2NRV9	1.33e-22	12	333	10	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1
C5BDQ8	2.40e-22	31	333	30	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q3KCC9	2.63e-21	31	339	48	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
A1JPM4	3.34e-21	17	333	18	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000003	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
82	104
111	133
161	192
199	221
256	278
291	313
318	335
340	362