CAZyme Information: MGYG000003466_01089

Basic Information

• Species: Treponema_D sp900767955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900767955
• CAZyme ID: MGYG000003466_01089
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31616.58	10.1718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003466	2580548	MAG	Fiji	Oceania

• Gene Location: Start: 41230; End: 42108 Strand: -

Full Sequence      

MSISKKSKINLFILVINILFICSVFADSYYTVKKGDTLYSISKKYQLTVPELRTANNLSE
NDVIKIGQKLIIPSADISNAAALSSTKEVPSNTSTKQNTKTYVVKAGDTLYGIARNSEIK
LHELLAMNNMDASTTLKVGQKILVPDNTKELPKKNEETKTPVTQKPAPTKDKDVVVSNGV
VWPLSNPKVKNIKGKVSGVQLIGEDNEVVKSVAAGTVMYTGVYRGFGEIIFVQSKTGLIY
AYSGLGTVKAKKGEYILSGDEIGKTSKSGDSSIKFMVFQNGKPIDPAKAPRG

Enzyme Prediction     

No EC number prediction in MGYG000003466_01089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	30	73	2.6e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0739	NlpD	4.02e-20	28	292	2	266	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.31e-18	30	193	408	573	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	4.97e-16	29	72	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	1.05e-15	30	186	333	495	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	2.45e-15	30	144	482	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL97450.1	9.21e-95	23	292	24	297
QTQ15942.1	4.41e-87	24	292	29	327
QTQ12082.1	6.25e-87	24	292	29	327
QTQ13716.1	1.15e-84	24	292	29	327
QQA02217.1	4.49e-71	20	292	16	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.46e-10	22	145	36	161	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
2MKX_A	1.18e-06	27	72	4	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36685	4.57e-12	101	285	119	337	Outer membrane antigenic lipoprotein B (Fragment) OS=Histophilus somni OX=731 GN=lppB PE=3 SV=2
P45682	3.96e-11	102	286	69	290	Lipoprotein NlpD/LppB homolog OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3623 PE=3 SV=1
Q46798	6.49e-11	102	288	42	240	Uncharacterized lipoprotein YgeR OS=Escherichia coli (strain K12) OX=83333 GN=ygeR PE=3 SV=2
Q56131	2.05e-09	28	288	115	368	Murein hydrolase activator NlpD OS=Salmonella typhi OX=90370 GN=nlpD PE=3 SV=2
P39700	2.08e-09	28	288	119	372	Murein hydrolase activator NlpD OS=Salmonella dublin OX=98360 GN=nlpD PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026627	0.500233	0.471753	0.000525	0.000377	0.000460

TMHMM  Annotations     

start	end
9	31