CAZyme Information: MGYG000003449_01649

Basic Information

• Species: CAG-312 sp002405555
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp002405555
• CAZyme ID: MGYG000003449_01649
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000003449_22|CGC1	36859.54	7.0833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003449	2395522	MAG	Fiji	Oceania

• Gene Location: Start: 94729; End: 95706 Strand: +

Full Sequence      

MKNTLKYLIATLAAAAFPLCGFAAFTEVSVKDKPVVQVPFKPFADEAPSLLPPNKKWKLV
WNDEFNGAEIDKTKWMCRESFWGQDFPAFAHNFEGVEMTGKTVRLHLLRKGDDFCSPHLQ
TGSLTYDIPKDSKGFWPFGKYRKPLFMHKYGYYEIRCKQPKNAGWHSAFWLQSPGIGSTP
NPEVSGVETDIMENYKQVSEGRIVGGNGWNGYGRDGKWFGHFSWEYEADADGWCYYGVDW
SPKGYTFYANGKKVGEQNSPVSHVEQFVLVSTEPRGYRNAQGNDGGLSSGSRVWGKPAPE
LFKAVLPDYFEVDFVRVYDEVPDKQ

Enzyme Prediction     

No EC number prediction in MGYG000003449_01649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	61	318	1.5e-23	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	7.70e-20	63	318	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	5.53e-15	149	318	78	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	1.32e-12	42	318	1	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	1.82e-07	53	277	37	240	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02177	GH16_kappa_carrageenase	2.22e-06	53	319	4	269	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34338.1	1.66e-116	47	321	10	288
AQT67838.1	5.70e-37	51	325	283	511
AQT67867.1	5.56e-30	50	323	381	609
ASO04996.1	1.01e-27	52	320	45	268
QJB31124.1	1.17e-27	57	318	56	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	4.45e-07	122	262	45	177	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
5WUT_A	1.67e-06	58	318	6	234	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	4.18e-07	59	320	425	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
A3DBX3	4.73e-06	122	262	74	206	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
Q84C00	8.43e-06	122	262	74	206	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003760	0.993042	0.002325	0.000388	0.000242	0.000216

TMHMM  Annotations     

start	end
7	26