CAZyme Information: MGYG000003449_00003

Basic Information

• Species: CAG-312 sp002405555
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp002405555
• CAZyme ID: MGYG000003449_00003
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	MGYG000003449_1|CGC1	89358.2	8.7708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003449	2395522	MAG	Fiji	Oceania

• Gene Location: Start: 2412; End: 4790 Strand: +

Full Sequence      

MIKRAILLATAATALAAPLFAVENKFTPIKETPAIWSNIPESLKSAKWLWDKYPAAFAEI
VNTYCVGRKTFDLDAVPKKAPLFITADQSYRLFINGKFVCSGPARGYQHSWPFDEIDVAK
YLKKGKNIIAVRAYNAGRSTFGYITQGRAGFIFALELGNGKNILSDGKVKVRRQSGCDRN
TAQFTIQLNNQEHIDLRVENPDWINADFDDSGWNTPQCFPYNIMPYYSMESRMIPMLEEF
EIFPTALVSRGEGKSGANAERVFDVAKLIGEENVPHVMKTENVKSVEAKPSKDAVQSFVF
DMGRMQVGMPILKVEGAKGGEIVDILTSEILKNGTGLSTGSSSAAYGNRLVCRAGDQTHQ
FYNIMGVRYMTIRVRNNPDSTLKITPSLMWSAYPLGDRGKFETSNALVNEIWKTCKHTQK
ICSLDAYVDTPYREQAQWWGDARVQSWNTFFISGDARLMRRGIRSISMQKAPNGLTYGHA
PTMAHSCILPDFALTWILTVYDHYWQTGNPEAYLSHKDTVASILSYFDGITNPKTGLAEF
DPRYWLFLDWTPTQKNGQPAILNFWLLNALESMQKLCAENGIGDDAKMYAERAAKVRKAI
TDNLLRKDGLISDGILPDGKLNPETGVHAQVLARMCNIEGFDFEKAKNEILLPFIKGEKT
FKAPPSAFWTVYVIKVMCDAGYNREVYEYIKRNWENYTKYGTTFEDFKEKPWNTHSHAWS
AHPVFMLPQILGGVKQEAAGWTKISFKPNFFEDYAKIVYPTPQGDIKVEWRKNADGTFSS
KIEKPKGVDIVK

Enzyme Prediction     

No EC number prediction in MGYG000003449_00003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	296	789	1.3e-85	0.9761904761904762
CBM67	46	217	5.5e-37	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.81e-17	399	721	4	330	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.61e-11	77	214	3	148	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	7.70e-06	733	788	1	57	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.001	298	379	8	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	0.010	68	141	114	185	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT92885.1	1.40e-223	38	788	2	756
QYY35421.1	2.73e-221	40	788	11	761
SDU02729.1	2.93e-213	48	789	18	767
AHF89243.1	7.54e-211	46	788	19	790
QYM78626.1	1.59e-195	40	788	10	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	4.71e-49	45	790	7	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	4.53e-19	356	768	262	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000348	0.998904	0.000163	0.000218	0.000175	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003449_00003.