CAZyme Information: MGYG000003448_00178

Basic Information

• Species: RC9 sp900767405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767405
• CAZyme ID: MGYG000003448_00178
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	MGYG000003448_15|CGC1	78532.8	4.9134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003448	1065599	MAG	Fiji	Oceania

• Gene Location: Start: 5780; End: 7873 Strand: +

Full Sequence      

MKSKLFSLSLIALALLLASSCKPTVTFTEGPLDPETGKGTYSIVIDNPPKGDNWAVWFSC
FRVRPQILEGSNATIEHLFGTLHKITPTADCKDKVVINFLASPLRRQSWAPEKFTLDIPG
MSPVELETEYIFQEAKDVPLFEYETVELDEFDIVPKPKIIDKRERKSILGVLSVDEIAQK
WQPDTVAGKVPGWYRIDIMSGEVNIQASDADGAFYAAVTLSKILRNGEGEVTNVTIEDWP
DLQYRGLMLDVARNFTTKDNVLKLIDVLAGFKVNVLHLHIADDEGWRIEIPGIPQLTAFS
AFHSLPVRQADGSYKEITHLAPTHSGDFDPNAGGSSTGFYTKADYIEIVKYAHKNHIRVI
PEIDTPGHFRAALRGMDYYCDQTGDESLRLTEPGDTSKYYSVQYFNDNALNVALNSSYKF
MNILMDTFIAYHNEAGVPLTEFHVGGDEVPGGAWMGSPACQALMQENGWTGAAQLKAYFL
RRVMSIAEAKGIKIAGWQETPQRLDTKTEDQMKRDLAFTNIWSTRPEGHSDELPYKMANK
GFNVILCNMTNAYADFAYNSSVLERGHDWGGLVDERRSFCLLPFNSYSSVRFDDSGAPAD
LTDAATGKTVLEAPERIMGVQAQLWTETIRNFDHVTYYIFPKMIGLWERGWNAHPVWEFS
KDAQDPAFTEDFNRFFSTVEQHEMPWFDQLGICYHKR

Enzyme Prediction     

No EC number prediction in MGYG000003448_00178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	243	653	4e-91	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	1.56e-159	238	675	1	441	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	6.98e-94	244	654	3	345	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	8.36e-92	244	653	3	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	6.47e-77	169	651	186	613	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	5.07e-62	244	651	3	314	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU58708.1	1.69e-144	2	692	3	763
QQR16377.1	1.69e-144	2	692	3	763
QIU93708.1	2.53e-143	193	692	259	762
QUT26545.1	4.01e-142	15	692	17	763
QUR45222.1	1.58e-141	15	692	17	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	8.61e-73	190	694	258	790	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	2.94e-71	190	694	258	790	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	1.46e-70	190	694	258	790	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	1.16e-68	192	696	209	639	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	1.49e-67	192	696	206	636	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.08e-84	152	694	225	778	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	6.17e-77	192	694	281	815	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
P49007	1.88e-75	40	697	59	771	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
Q54468	6.83e-72	190	694	285	817	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P96155	7.24e-66	121	646	116	600	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000012	0.008740	0.991289	0.000003	0.000004	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003448_00178.