CAZyme Information: MGYG000003444_01326

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003444_01326
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38804.35	5.053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003444	1503598	MAG	Fiji	Oceania

• Gene Location: Start: 4618; End: 5652 Strand: -

Full Sequence      

MDRLERTVIALALTLIAGVFAMSRFIPDAPEEDQRRKSFCAAIEMSAYRDTSKALGIGYN
YMMLREFAKDMEMADTIELCPAGQSRSDSLLTGAIDILVLPYSDSIHIEGTAASSPVDSI
SMWVVRAGDRDLLADIDSWLEECRASGRFNSVKDRYLRHSSPYRCGRRGWISPYDSLIKV
HADSIGWDWRMMAALIYKESRFHIEAISARGATGLMQLMPATARRMGFEELVDPEKSIQA
GARLLGRLSNRYRDMAADRDELEKFVLAAYNAGTGRLRDCINLARQKGMEPRYWDDILAV
LPEMRDSTILDNEDVQLGIFKGEETASYVNTVINIYDCFKNICP

Enzyme Prediction     

No EC number prediction in MGYG000003444_01326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	187	338	1.2e-24	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.95e-53	178	341	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	1.99e-31	123	302	211	396	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.48e-28	123	302	230	415	membrane-bound lytic murein transglycosylase MltF.
cd00254	LT-like	4.25e-25	190	299	2	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.22e-23	173	337	3	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	1.64e-52	57	288	59	293
AGY53417.1	2.80e-47	58	340	60	348
QUB48180.1	1.08e-44	56	344	74	369
AHM60830.1	3.12e-43	123	344	273	503
QRO51446.1	6.13e-43	107	341	216	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.49e-25	123	337	199	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.60e-25	123	337	206	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.60e-25	123	337	206	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	8.78e-25	123	337	192	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	8.78e-25	123	337	192	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.46e-33	123	340	227	449	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q4KHS7	1.01e-27	123	337	229	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
B0KRE9	8.97e-27	123	337	229	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1
Q3KHL5	1.69e-26	123	337	229	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
A5VZC8	4.28e-26	123	337	229	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.502620	0.489971	0.005746	0.000490	0.000318	0.000851

TMHMM  Annotations     

start	end
7	26