CAZyme Information: MGYG000003444_01261

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003444_01261
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41307.93	5.1615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003444	1503598	MAG	Fiji	Oceania

• Gene Location: Start: 11; End: 1099 Strand: -

Full Sequence      

MDRNDMETPVWKSVMVTRHLPEELSGLETLCKNLWWCWNDSAKALFKTVDADLWHKSGHN
PMEILDKVSLKRYKELAKDGEFLSRLAAVMKEFESYMDAKSKRTEPSVGYFCMEYGLDTS
LKIYSGGLGILAGDYLKETSDMNVNLVAVGLLYRYGYFTQRLTPQGNQVAEYDAQDFLKI
PAEPVFDKDGNWLSISIQLPGRLMSARIWKVAVGRTDLYLLDTDFEANSPEDRQVTHQLY
GGDWENRLKQEMLLGIGGVRALRALGLNPTIYHYNEGHAAFAGLERLREYMQSGHLSFNE
AVELVRASGLYTTHTPVPAGHDAFTEDLLGRYLGQYPQLFGIDWREMMALGKIDAYNYDE
KF

Enzyme Prediction     

No EC number prediction in MGYG000003444_01261.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04299	GT35_Glycogen_Phosphorylase-like	5.02e-158	27	362	1	340	proteins similar to glycogen phosphorylase. This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism.
COG0058	GlgP	1.73e-90	27	345	6	342	Glucan phosphorylase [Carbohydrate transport and metabolism].
pfam11897	DUF3417	6.12e-42	20	121	1	109	Protein of unknown function (DUF3417). This family of proteins are functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are typically between 145 to 860 amino acids in length. This protein is found associated with pfam00343. This protein has a conserved AYF sequence motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACM90985.1	5.26e-175	3	362	561	920
ACU92833.1	6.27e-150	6	362	568	924
AVM55254.1	6.27e-150	6	362	568	924
ALC97942.1	6.27e-150	6	362	568	924
QLF50715.1	8.76e-150	6	362	568	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LR8_A	1.11e-07	81	348	108	413	Structureof plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LR8_B Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LRA_A Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRA_B Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRB_A Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare],5LRB_B Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9YGA7	7.98e-87	20	352	12	347	Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=malP PE=1 SV=1
P9WMW1	6.22e-80	16	354	9	371	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1
Q7U078	6.22e-80	16	354	9	371	Glycogen phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=glgP PE=3 SV=1
P9WMW0	2.34e-79	16	354	9	371	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgP PE=3 SV=1
O66932	4.39e-65	26	351	9	334	Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003444_01261.