CAZyme Information: MGYG000003443_00287

Basic Information

• Species: UBA1067 sp900767325
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067; UBA1067 sp900767325
• CAZyme ID: MGYG000003443_00287
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000003443_28|CGC1	34415.16	5.4093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003443	1101788	MAG	Fiji	Oceania

• Gene Location: Start: 5690; End: 6598 Strand: +

Full Sequence      

MQLENCCYGEVEMLTFNLAKLGMLGEILHGEGAYIHDLRNMVEENYPDYEYWRYPHNRDH
AGNRYVTHGLVPLCLTMDINRGDRMDYLVSMDNKEANFRLYKDNHLKKDDPRFAEAMKTG
DMNTSLIRTINGKTIMIQHDVSSPRPYTRIQLVSGTKGIVADYPFRVALEKTNGAGAHEW
FGDEAAEEIATKYMHPLYKSIGELAKRVGGHGGMDFIMDARWVYCLQQGLPLDMDVYDLA
STCCLGELTEKSVLNRSKAYDIPDFTRGAWRTNKPMEVVDIDIEKFGLKASEVEKADAQM
SV

Enzyme Prediction     

No EC number prediction in MGYG000003443_00287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	272	1e-100	0.6691729323308271

CDD Domains     

MGYG000003443_00287 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH43080.1	6.14e-92	1	302	188	486
QHT71107.1	1.31e-90	1	287	188	467
QGA23904.1	1.40e-90	1	270	185	452
ASZ14077.1	2.26e-90	1	287	191	472
BBD44693.1	2.72e-90	1	270	174	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.56e-68	1	282	168	450	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	8.75e-48	1	282	146	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01S58	2.80e-85	1	276	170	438	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
P0C863	1.02e-82	1	274	179	456	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	1.02e-82	1	274	179	456	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZW9	1.64e-82	1	274	145	418	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4252 PE=3 SV=1
A1S4U5	8.95e-82	1	280	178	455	Glycosyl hydrolase family 109 protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=Sama_1194 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003443_00287.