CAZyme Information: MGYG000003435_01797

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000003435_01797
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		40099.99	5.9021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003435	2203968	MAG	Fiji	Oceania

• Gene Location: Start: 294; End: 1367 Strand: -

Full Sequence      

MALYLAATDWKADIVHCHDWTTGLVPYYLKYFKVETKTVFTIHNLAYQGVFPPFDAIISS
SRIPHSALRGPKAHENINMMVAGLMDSDFITTVSPTYMEEIRGSAMGCGLDDILRARKDK
SKGIINGIDYNEWNPEIDKDIVANYSSENREGKEECKKDLLKEFKLQGYDDKPLFSMISR
LADQKGFDELLLEGEPCALERILKNDDCAVVLIGTGDAKYVTKLSLLMSKYKNLSVKIAF
SAPLSHKAEAGADFFLMPSRFEPCGLNQLYSMKYGTLPIVHTTGGLKDTVIDMTNEDGTG
FAFSPLTPDKIVETVERAKAFYKDKEGLDKARERAMKVDSTWKHSAEEYIKVYSSIL

Enzyme Prediction     

No EC number prediction in MGYG000003435_01797.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	4	354	7.4e-128	0.7457627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	2.61e-163	2	357	109	464	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.15e-157	5	355	122	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	5.22e-142	2	356	119	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	5.94e-124	9	357	128	479	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	8.88e-96	13	357	135	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEC02159.1	1.49e-106	7	356	127	483
ADY13723.1	9.53e-104	2	355	119	479
AEV30816.1	1.06e-100	7	355	125	479
AJY69482.1	6.86e-89	4	353	123	475
ADI85999.1	6.86e-89	4	353	123	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	2.80e-68	10	357	129	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
1RZV_A	1.28e-65	10	357	129	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	1.61e-64	10	353	128	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.94e-64	10	353	128	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
4HLN_A	7.30e-64	18	353	269	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8GNA4	1.88e-89	1	357	125	482	Glycogen synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) OX=396588 GN=glgA PE=3 SV=1
Q747K8	5.45e-89	4	353	123	475	Glycogen synthase 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=glgA2 PE=3 SV=1
Q39QT6	8.38e-85	4	353	123	475	Glycogen synthase 2 OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=glgA2 PE=3 SV=1
A8F720	1.25e-84	13	357	133	481	Glycogen synthase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) OX=416591 GN=glgA PE=3 SV=1
Q1DCS0	2.16e-83	13	357	133	475	Glycogen synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003435_01797.