CAZyme Information: MGYG000003424_01443

Basic Information

• Species: SFTJ01 sp004557385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp004557385
• CAZyme ID: MGYG000003424_01443
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000003424_116|CGC1	30614.34	8.5587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003424	2699357	MAG	Fiji	Oceania

• Gene Location: Start: 85; End: 900 Strand: -

Full Sequence      

MKFVLNLPVKKQRNAMRKMMLMMVAAIMCVAATAQERYEKRELIVGGDTLRYCALAPQQI
EQGKSYPLVVFLHGAGERGEDNQAQLLHGSQQFLNPVNREKYPCYVVFPQCPSGKYGAYI
NRPLSLVPSEMTIQEQPSAFVSQVHQLITKYLAEQHVDSRRVYVIGLSMGAMATYDMVIR
YPELFAAAVPICGTVNPERITEAVKHTKWSIYHGDADTTVPLDGSREAYRKLRAVGAEVK
YTEFPGVAHGSWNPAFSQPDFMKWLFDQSRE

Enzyme Prediction     

No EC number prediction in MGYG000003424_01443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	49	251	3.6e-27	0.8854625550660793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.38e-44	47	270	171	387	Predicted peptidase [General function prediction only].
COG3509	LpqC	2.53e-14	15	224	1	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	4.86e-12	47	269	375	617	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	5.61e-12	67	249	19	188	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	5.84e-10	67	253	15	203	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	9.98e-45	32	271	805	1044
ABS60377.1	8.67e-42	59	271	30	246
QDU56037.1	1.26e-34	50	270	801	1007
ACR12533.1	1.47e-24	49	268	63	279
ANB19106.1	1.06e-23	57	268	51	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	2.15e-45	47	270	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	2.06e-21	43	251	14	199	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	5.44e-13	67	270	81	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
5E4Y_A	2.58e-06	55	196	30	179	Orthorhombicstructure of the acetyl esterase MekB [Pseudomonas veronii],5E4Y_B Orthorhombic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_A Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_B Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_C Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_D Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_E Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii],5EFZ_F Monoclinic structure of the acetyl esterase MekB [Pseudomonas veronii]
5X6S_A	3.60e-06	100	220	58	205	Acetylxylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52090	3.34e-08	67	193	66	179	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
Q0J968	3.78e-08	66	268	9	216	Probable carboxylesterase Os04g0669600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669600 PE=2 SV=1
Q96W96	8.62e-07	100	220	86	233	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
A2QZI3	2.80e-06	100	220	86	233	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004817	0.988636	0.005685	0.000400	0.000224	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003424_01443.