CAZyme Information: MGYG000003423_02047

Basic Information

• Species: W3P20-009 sp900766825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; W3P20-009; W3P20-009; W3P20-009 sp900766825
• CAZyme ID: MGYG000003423_02047
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	MGYG000003423_90|CGC2	87579.69	6.9389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003423	2824109	MAG	Fiji	Oceania

• Gene Location: Start: 14007; End: 16403 Strand: -

Full Sequence      

MHTISQHIISFCRSFRSQIITILVAVALLATLHAFVPRPLFSSPRSKVLKSADGQLLSAR
IASDGQWRFAPSDSVSSKFEACLLTFEDRRFRFHMGIDPIALARALWVNIRHGSVHQGGS
TLTMQLARMARGHKERTLYQKLVEALWAADIELSYSKDQILALYASNAPFGGNVVGIEAA
AWRYFGRSPNDLSWAENATLAVLPNAPALINVGRNRQALKQKRDLLLSQLADRGLLDPDE
LLMALAEPLPDKPFPLPNMAPHLLSTLASQNWTSSFNSTLSFSLQSRVQRIADDYSARYR
ANLVADIAILVADVASGHVLAYVGNTTLPSSSSDVDMIQAERSTGSILKPFLYAAMMSAG
EITPAMLFADTPLDVNGFSPKNFDHSYSGAVGANVAITRSLNVPLVRMLSLHNTGRFMAD
LKQLGMTTLHFSEDHYGASLILGGAEATLWDLCGMYASMARRLNLFNDNVEHNIVTSDQD
FQLATFPLSALPTTPESRGASHPKHQISATPLSASAIWHTFCAMANLNRPEEEADWQLFS
SMKQVAWKTGTSYGSRDAWAVGVTPRHVVGVWVGNANGEGRAGLSGVGFAGPVLFDVFSL
LPTDGWFAEPLEDEIPLPVCRHSGHRASDACPLVDTLLLPCQSQTTPLCPYCRIVHLSPD
GLWQVNSSCMSVSNMVNQKRFVLPPAMEYFFCRTHADYVPLPPPDPNCVPEGRKPDIIYP
NNGQVIVRVRDFNGQEQGFVARAAPVEHNGVLHWHLDAHYVSTTYNNHSLRLSPEPGQHS
LTVVDDSGDSRTIFFSVR

Enzyme Prediction     

No EC number prediction in MGYG000003423_02047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	66	230	2.3e-49	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	37	797	2	726	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.16e-164	19	797	8	731	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	4.48e-113	7	797	1	771	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	2.26e-91	69	593	4	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.18e-90	8	596	14	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47706.1	4.16e-287	32	798	17	781
QIX67622.1	3.60e-284	32	798	11	775
BBK90937.1	1.45e-283	32	798	11	775
AST53363.1	1.58e-283	24	798	76	848
QRO17107.1	3.18e-283	32	798	84	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	7.92e-31	66	240	18	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.08e-30	66	240	18	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	7.41e-29	53	579	141	672	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	7.86e-29	53	579	162	693	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	3.55e-26	53	579	145	676	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.68e-84	37	795	33	767	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P45345	2.61e-35	57	586	157	692	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
Q9KUC0	8.01e-35	83	579	196	693	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O66874	1.91e-32	66	574	61	639	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q4UK08	5.12e-30	69	574	69	688	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000017	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
19	36