CAZyme Information: MGYG000003421_00598

Basic Information

• Species: CAG-115 sp900766795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp900766795
• CAZyme ID: MGYG000003421_00598
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43074.93	5.3127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003421	2989686	MAG	Fiji	Oceania

• Gene Location: Start: 4179; End: 5297 Strand: -

Full Sequence      

MSYKTDINALLKELDSKPVTTDRLVTDCPTPNTLRLYRFLTEIRGKKFIAGQQYLFEDEY
EDLVYFKVSGKLPALRGYDFMGISGLGGGYDQINRALDWARSTGGILTMCWHWYAPDDMS
DFNKGSSFYYKTTGYSHKTSFDIIRAVCDGTAENEFVLREIDLVAEALKQFEREDIPVIW
RPLHEANGNWFWWGNRGKDSVEAYKKLWYIIFDRFMNLHKLKNLIWVWNGQDKEMAVHPN
TFDIAGDDIYTDPPAHISHSARFKALSELSAGKPLALSECGSIPEPDEMQRDGAEWLWWL
PWWGQFVYTPAKNGLPALDEEGLPTINPAYMDEDFLKRVMNDERVVTLDKLPWRDSRKHG
LPSMLKKHLSEI

Enzyme Prediction     

No EC number prediction in MGYG000003421_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	26	349	9e-84	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.84e-40	25	304	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	9.82e-10	176	281	180	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34792.1	1.54e-156	1	372	1	359
CBK96404.1	4.41e-156	1	372	1	359
CBL34396.1	3.77e-95	1	366	68	436
CBK96003.1	7.53e-95	1	366	68	436
AIQ56350.1	4.52e-73	10	352	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDQ_A	1.15e-48	25	352	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	1.16e-47	70	351	49	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	2.91e-47	32	363	153	460	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	2.02e-43	15	303	32	315	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	6.29e-33	67	312	66	311	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	3.29e-48	30	360	152	467	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	1.32e-46	49	351	54	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	6.83e-46	36	356	186	482	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	2.65e-43	30	349	34	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	5.70e-39	15	352	147	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003421_00598.