CAZyme Information: MGYG000003421_00003

Basic Information

• Species: CAG-115 sp900766795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp900766795
• CAZyme ID: MGYG000003421_00003
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		38099.17	5.4464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003421	2989686	MAG	Fiji	Oceania

• Gene Location: Start: 1671; End: 2636 Strand: -

Full Sequence      

MERLFCKGYTWGFFAGSGAYQTEEAMRSMERLHSNGLDWICIPVNAFQEHFYSTMVHPVY
GRTQTDEDIAFAVGYAKKLGMKVCLKPMVDCLDGVWRARIHFTDESRIDYNDRWFRSYTE
FLLHYARIAEKTGCEMFCTGCEMDGMDVNTERCIELIAKVREVYHGLVMHNINHGDEFKY
PWLGEVDVIGVSGYYRVTDGVDVGIDRMLESWSRVKETLAKMHRYYDKPIMMAEIGVRNE
HGCSKYPYDFRNRPEIPCDEDEQADFYESALRTFWDEEWFSGFFWWDWKARLTPDDRIHE
NRDFTIYGKKAEQVLKKWYTK

Enzyme Prediction     

No EC number prediction in MGYG000003421_00003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	6	316	1.8e-96	0.9934640522875817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	1.52e-95	7	319	4	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	4.57e-72	5	319	1	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05952.1	1.25e-156	4	321	5	321
ADU22262.1	1.35e-151	2	320	3	321
QNF27001.1	7.14e-116	1	321	1	319
AGA57019.1	6.29e-111	1	319	1	318
ALS26290.1	6.49e-109	2	320	3	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DVZ_A	1.87e-66	5	320	37	341	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVZ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DV7_A	5.26e-66	5	320	37	341	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DV7_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVJ_A	4.15e-65	5	320	37	341	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVJ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
4CD6_A	8.33e-64	5	315	12	310	Thestructure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG [Alicyclobacillus acidocaldarius],4CD7_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD7_B The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD8_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManMIm [Alicyclobacillus acidocaldarius]
3CIV_A	1.59e-63	5	315	35	333	Crystalstructure of the endo-beta-1,4-mannanase from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003421_00003.