CAZyme Information: MGYG000003420_00111

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_00111
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43611.93	9.2092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 13024; End: 14163 Strand: -

Full Sequence      

MNNSLLFLSNLLLRACRPIPFAQHIIPMLMAAFLLSPSLLIARTGKGLKHAYRNSFDVGV
GLNLRNVTVKGQRDLIVANFSTATAENAMKPASVQPREGVFTWEAADSIANFCRRNGLKM
RGHCLCWHNQFADWMFVDSMGNPVSKEVFYERLRTHIHAVVNRYKDVVYAWDVVNEAIAD
GPDTISCPYRITRHYRLCGDEFIVRAFEYAHEADPKALLFYNDYSTVDPAKRDRIVNMLR
KLRQQGAPIHGLGMQAHYNIYWPDRTLLETAIEAFSRVVDVIHITEMDVRASHEHGGQLT
FSQGTSLVPDSVTLSRFDRQYRMLFEVFRRHSNLIRNVTFWNLSDNDSWIGAANYPLLFD
KEYRPKPTYFSVRDLGRSR

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	48	374	8.9e-103	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	2.89e-109	89	372	1	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	2.06e-105	48	374	1	310	Glycosyl hydrolase family 10.
COG3693	XynA	2.14e-92	80	374	58	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ02686.1	1.34e-144	47	376	37	372
AGC54684.1	2.56e-139	45	374	31	369
QVJ82151.1	2.72e-136	45	374	30	368
ACN78954.1	3.85e-136	45	374	30	368
ADE83639.1	3.85e-136	45	374	30	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AY7_A	1.80e-127	43	374	14	345	Apsychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5AY7_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5D4Y_A A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples],5D4Y_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples]
6WQW_A	3.94e-98	52	372	10	326	ChainA, Beta-xylanase [Thermobacillus composti]
3EMC_A	2.18e-91	48	372	7	327	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]
1N82_A	1.59e-88	48	370	8	326	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	8.98e-88	48	370	8	326	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	7.69e-137	45	374	30	368	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
O69231	1.23e-90	48	372	8	328	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	6.20e-82	48	372	8	327	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P10474	6.73e-78	51	372	48	369	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
P40944	1.46e-77	52	374	360	677	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 GN=xynA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.806000	0.191578	0.001127	0.000240	0.000194	0.000880

TMHMM  Annotations     

start	end
20	42