CAZyme Information: MGYG000003419_00498

Basic Information

• Species: RF16 sp900766775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900766775
• CAZyme ID: MGYG000003419_00498
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003419_73|CGC1	42211.39	4.7911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003419	2335712	MAG	Fiji	Oceania

• Gene Location: Start: 9521; End: 10630 Strand: -

Full Sequence      

MKRICLNIILLLTGVMASCGQPAPSTPPDSPKPSYRLCNPNATAEAQKVFEVLSRLYGEK
IISGTVALVDWNTTEAEHVYEWTGRYPALNGFDFINIANSKDVNPSGWLDYSDISVVEAW
WRAGGLVSGMWHWQMPTNSGNGMTCTPGSGAQETAFDCSKISDKQSSEYKRVVQDIDQVA
GYLKKMQRQGIPVLWRPLHEAAGNTYEFDSGKAWFWWGAQGAEAYIALWRLMYDRLVNYH
GLNNLIWVWTAQTGDHSWYPGDEYVDIVGRDNYYALQYPLAKEYKALSEQYPDKMITLAE
CGNGDQVDMSLLSDIWAEGGKWSWFMTWYDYSYQQGSTRHRYADRAWWTEAFSQPYVVTR
EQMKELLEQ

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	39	361	4.8e-94	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.63e-55	39	334	2	288	Glycosyl hydrolase family 26.
COG4124	ManB2	2.08e-17	166	273	157	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	1.75e-107	45	366	126	448
ARK08557.1	4.55e-101	29	366	134	455
QIK58757.1	1.28e-100	29	366	134	455
AHW58761.1	1.32e-98	33	366	43	369
QIK53340.1	2.31e-98	29	366	134	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	7.56e-96	8	363	9	356	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	2.06e-76	37	365	4	336	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	4.52e-72	37	365	95	427	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3ZM8_A	9.68e-49	28	330	132	418	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	8.09e-48	40	363	37	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	5.55e-53	32	330	141	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	2.16e-49	28	330	161	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55296	1.77e-41	23	328	142	429	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55297	3.01e-40	37	328	158	430	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	5.60e-40	30	328	149	428	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000044	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003419_00498.