CAZyme Information: MGYG000003417_02168

Basic Information

• Species: Firm-11 sp004556545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp004556545
• CAZyme ID: MGYG000003417_02168
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	MGYG000003417_201|CGC1	77884.88	5.3314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003417	3316884	MAG	Fiji	Oceania

• Gene Location: Start: 20295; End: 22352 Strand: -

Full Sequence      

MNCMTSTLCLKSTDFTLLKGQRREDGFLPEGHELLLSAALPEDWQRHETAAVTLRAEADH
QVEVRLEFCAAVQEEPLLSLHYRILTGCGVQIPFPIDKRALAADMAFLPPWPGVFKGGIN
GRPIQPGEVRFVRLSLREPSLRFVSLSSLAFTDGWQPQDVEGQPRVDALGQRAEGSWPGK
TADLAELDAYLKKELEWAGTHNHYPEGWSRCGGWLQKRFDQTGWFHTVHDGRRWWLVDPD
GYAFFSNGMCYGNRTGIYGMADHLSSLHQWLPPKEGLFARAWTTGDQIPQYVVRNGLENA
KARELVNFPRANMMRVFGENWLDAWITINTARMRSWGINTLGVGVNDYGDEPTAEFLRKA
QMPYVITFKFFPLTEERIFRDFPDVFSPEYERLTAEMARRELRAYRDDPLLIGYFVTNEP
EWLMSENVNLAERLLAAEGCRASKQAFASHLQKQYGTADALNAAWATAFSSFEDLLAPLR
LENRTEAARKDLEVFHNLLVERYGRVISDALRAEDPHHLNLGMRYSHASDKTLCGPLNYF
DVFSFNCYGAEPATAAAQMGRGANLPMVVGEWHIGAAESGLDSWGIYYTDTQARRAEALQ
YYLEQSTQEAHLTGIHYFEYSDQPYLGRFDGECYQIGLIDVCNRPYPLAAETFRAFAERM
YPLLDGQEQPTAHPVPLKNLWQTVN

Enzyme Prediction     

No EC number prediction in MGYG000003417_02168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	151	661	8.8e-92	0.7947932618683001

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	3.29e-07	387	481	105	193	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV29398.1	4.23e-183	13	670	8	675
QHW33563.1	7.39e-129	26	671	38	666
QYR22516.1	5.34e-127	78	673	81	650
AIQ75804.1	1.82e-126	60	670	66	654
AWV35106.1	5.58e-125	60	670	66	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	1.12e-42	166	661	204	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	2.74e-42	166	661	204	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	4.33e-41	166	662	223	760	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	3.74e-38	166	661	223	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.49e-40	166	663	432	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	1.19e-28	166	661	399	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003417_02168.