CAZyme Information: MGYG000003414_01400

Basic Information

• Species: Acinetobacter sp900766635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter sp900766635
• CAZyme ID: MGYG000003414_01400
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000003414_291|CGC1	28292.99	10.1004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003414	1693287	MAG	Fiji	Oceania

• Gene Location: Start: 1793; End: 2575 Strand: +

Full Sequence      

MKIDSIIWAMCTAVGTLCLSPLSFAGETIYQLKERNGTTLLTNKHSKYRDLKVEKKTYYP
ESNIHQYRNYGATEAAVAPSQSRNKHAFDSIIQQAAQTYGVSAGLIKAVMHTESGFNIHA
RSPVGAQGLMQLMPATARRFNVSNPYDPQQNIMAGAKYLAWLLKRFNGNTSLALAGYNAG
EGNVQKYGGIPPFRETQDYVRRVQSRYQNLYAGGLGISTNQSSTLTASASNAIPAGSTLI
AQSNQSSSPTPPLTAVRLFS

Enzyme Prediction     

No EC number prediction in MGYG000003414_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	105	211	6.1e-34	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	6.22e-54	103	208	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.47e-46	87	203	5	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	6.38e-44	91	208	7	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	8.96e-42	92	210	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.16e-38	92	199	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXR20181.1	1.25e-116	11	222	10	224
QKY91353.1	1.25e-116	25	243	27	236
QSE46692.1	1.25e-116	25	243	27	236
QKW83577.1	1.67e-116	17	224	7	214
BCT88501.1	1.67e-116	17	224	7	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.81e-16	89	205	418	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.82e-16	89	205	422	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.84e-16	89	205	428	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.86e-16	89	205	432	564	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.88e-16	89	205	438	570	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.83e-45	72	207	35	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	6.01e-40	63	207	1394	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	6.01e-40	63	207	1394	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.32e-13	92	216	11	127	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q0A9W6	2.41e-12	67	185	275	395	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.010242	0.786011	0.202706	0.000354	0.000306	0.000335

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003414_01400.