CAZyme Information: MGYG000003406_00830

Basic Information

• Species: Veillonella sp009929605
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp009929605
• CAZyme ID: MGYG000003406_00830
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		41543.92	7.3331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003406	1742690	MAG	United States	North America

• Gene Location: Start: 576; End: 1682 Strand: -

Full Sequence      

MHATPAARWIKEHYPEAKLHWIVTPTMAEILRHNPYVDEIIEWERDAYEAHSKKIHIPTM
WRMCWELREKIKPYKFDVAVDVQGRLITGLVLLASGAPIRLGLGGTKELNWLFTNFKSEA
NQDHVIKRYLQVAQLLPKALEKHGFSAVSLGVSQSDGIDLQMVLNLSESEIAWAQAEVDT
YFNKLVHDSNILSPEVAIPTTQTQSRRARIAIVPGASWASKEWPIYHWTSLVRALLPEMD
IVYVGGPKEAREFSPQLPQGEHVYDMMGKTTIRESAALIKACDIVVSGDTGSLYMATAEM
VPSVSLFGPTKPQQWGPITGSYHVLQQSDMDCLGCRKRKCPKGHHNCMNELTPERVAQVI
RELVTRTI

Enzyme Prediction     

No EC number prediction in MGYG000003406_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	65	346	1.6e-53	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.88e-60	1	362	14	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.49e-51	1	365	16	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.87e-32	65	344	2	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	4.06e-14	207	363	180	342	ADP-heptose--LPS heptosyltransferase RfaF.
PRK10422	PRK10422	1.20e-05	268	322	249	303	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU35857.1	4.31e-140	1	364	15	383
VEG92969.1	7.04e-139	1	364	15	383
CAB1274687.1	7.28e-139	1	367	15	387
BBU33942.1	1.41e-138	1	364	15	383
SNU95034.1	8.39e-138	1	364	15	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.51e-10	4	364	26	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.29e-12	2	325	24	299	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003406_00830.