CAZyme Information: MGYG000003405_00185

Basic Information

• Species: Leuconostoc citreum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
• CAZyme ID: MGYG000003405_00185
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	MGYG000003405_3|CGC3	81540.84	9.3427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003405	1610057	MAG	United States	North America

• Gene Location: Start: 100587; End: 102716 Strand: +

Full Sequence      

MLLKHTKVGKLFVKKLEINMTSVLYLLLGIGLTFDVVLSVLKQTDFYDNVRLIGFLIIPI
ILMTYIIGTQTGRASLYKSILLTLISSFIFAANINLFLTHSIETTPILNTVSLVAITGLQ
NVFSNRPSFLKLTTFRNWYFGISGCLISATAIISFITINQKLGILQFIPTILHMILAGFV
SLVFGMTMIMQLHKQSQLIVVVFVMAILVALGFGFYTADSSLFFLQMTLGLLLIVETWYT
GISTYFNSYQKVLLFIISSLPLLFFFRSNIEGINYFKEFFYLLIKNFTWFAVFFSVLTFI
YYTIETLLLWSAYRTKYFTSDLSDVQINTEYRMVILIPCMNEAAVIKDTVKSLLATNYDA
LDIYVIDDASTDNTVQQVEEFKDNQKFHLLKRVKPEAQQGKGKALNWAYKKVTESYLKQG
YILEDTLVTIIDADSSVDTDYFDKVNLVFNSDFELTGLQSKVQVLNKNRDVSQDLEFREI
INATQSLRSRMNTVAFGGNGQFCKLSTLFALHEDPWTTSLVEDFDLSLRLFLSAIYNVRN
VQYDDIQIKQTGIYNDTKALVKQRVRWAQGNVQTFKYLGKIMKSGELEKKQKLEFFFTLI
KPWLMAIEYLVVIYTGIVLLGTLLLFGFNVASRSFITVFVCMVLYIFLINIVWAILYSKN
TREKLSILLVLKDAYYLTRFLVILSQIYPQAILRYFNAQNTWDKTNRQN

Enzyme Prediction     

No EC number prediction in MGYG000003405_00185.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	333	568	3.6e-21	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06436	GlcNAc-1-P_transferase	2.08e-66	335	523	1	191	N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine. N-acetyl-glucosamine transferase is responsible for the synthesis of bacteria Poly-beta-1,6-N-acetyl-D-glucosamine (PGA). Poly-beta-1,6-N-acetyl-D-glucosamine is a homopolymer that serves as an adhesion for the maintenance of biofilm structural stability in diverse eubacteria. N-acetyl-glucosamine transferase is the product of gene pgaC. Genetic analysis indicated that all four genes of the pgaABCD locus were required for the PGA production, pgaC being a glycosyltransferase.
cd06423	CESA_like	3.53e-32	335	523	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	5.26e-23	287	696	10	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	4.64e-19	279	613	15	309	N-glycosyltransferase; Provisional
cd06438	EpsO_like	4.74e-18	335	523	1	180	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA35871.1	0.0	14	709	2	697
QOY98013.1	0.0	14	709	2	697
QEA54613.1	0.0	14	709	2	697
QSR12063.1	1.09e-278	14	708	2	709
QSQ99901.1	1.54e-278	14	708	2	709

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HCN1	1.30e-16	290	570	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.30e-16	290	570	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.30e-16	290	570	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	1.30e-16	290	570	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q9RQP9	1.30e-16	290	570	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40
50	69
76	98
102	124
137	159
163	185
198	218
223	245
252	274
289	311
609	631
635	657