CAZyme Information: MGYG000003401_00844

Basic Information

• Species: Staphylococcus capitis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus capitis
• CAZyme ID: MGYG000003401_00844
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000003401_17|CGC1	34624.16	10.1322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003401	2394594	MAG	United States	North America

• Gene Location: Start: 70796; End: 71710 Strand: -

Full Sequence      

MHNNKNISQSTDRYVQFERIYKKIKHICVGIFVVFSIIGIALILALVIYFHHLTKEASSI
SDKELKQKVLHLPGDELINHSNKHILEEYDHSLNTLIVGPKSVNPNVIKALTSSEDTLFY
KHNGILPKALMRAMYQDIIDANETSGGSTITQQLIKNQVLTDKKTYSRKANEIILAMRLE
KLLSKNEIIYTYLNIVPFGHDYNGANITGIASASYSLFGVAAKDLNIAQSAYLVGLLQSP
YGYTPYDNQGNLKSNRILHYSIHRQRYVLKRMLVERKISKKQYIKAKKYRIKSHLLTHPP
QQGA

Enzyme Prediction     

No EC number prediction in MGYG000003401_00844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	88	272	1.7e-53	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.58e-69	19	292	10	260	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.41e-66	94	273	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	7.70e-49	20	299	1	263	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	8.41e-39	103	283	66	231	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.31e-30	105	301	76	256	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX60514.1	2.97e-213	1	304	1	304
BAW90537.1	1.41e-211	1	304	1	304
ATN02554.1	8.15e-211	1	304	1	304
AKL92157.1	3.32e-210	1	304	1	304
QKH90876.1	2.24e-208	1	304	1	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JE5_A	1.11e-43	63	296	22	255	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3UDF_A	8.23e-26	81	286	26	216	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3DWK_A	8.30e-25	78	302	10	220	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	9.59e-25	108	273	52	203	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OLU_A	9.87e-24	78	302	19	229	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	1.17e-26	76	256	42	223	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q8XJ01	2.35e-25	97	283	93	274	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	2.60e-25	97	283	93	274	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	3.50e-25	97	283	93	274	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
P70997	4.36e-25	72	281	51	246	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49