CAZyme Information: MGYG000003392_01486

Basic Information

• Species: Streptococcus mitis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mitis
• CAZyme ID: MGYG000003392_01486
• CAZy Family: GH20
• CAZyme Description: Beta-N-acetylhexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1346	MGYG000003392_161|CGC1	149499.45	4.6978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003392	1810665	MAG	United States	North America

• Gene Location: Start: 7197; End: 11237 Strand: +

Full Sequence      

MKQEKQQRFSIRKYAVGAASVLIGFAFQAQAVAADGVTPTTTENQPTIHTVSDSPQPSEN
RTEETPKAELQPEAPKTVETETPTTDTVASLPKTEEKPQEEVSSTPSDKEEVVTPTSAEK
ETTDKKAEETSPKKEVPKEANSKESDTDKTDKPEADKDKPAEKDAKKDEPKAEADKPATE
AGKEGAATENEKLAKRKIVSIDAGRKYFSPEQLKEIIDKAKEYGYTDLHLLVGNDGLRFM
LDDMSMKVGDKTYSSDDVKRAIENGTNAYYDDPNGNHLTESQMTDLINYAKDKGIGVIPT
VNSPGHMDAILHAMKELGIENPNFDYFGTKSERTVDLNNKQAVDFTKTLIDKYANYFSKK
SEIFNIGLDEYANDATNAKGWSVLQADKYYPNEGYPEKGYEKFISYANDLARIVKSHGLK
PMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYV
LGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADVPIIGGMVAAWADTPSARYSPSRLF
KLMRHFANANAEYFAANYQPAEKALETIPKDSNRYTAESFAAVKEAEKAIRSLDSNLSRA
QQDTIDQAIVNLQEAIKNLALTPEAQKEEDAKRELEKLNKNKVISIDAGRKYFSLDQLKR
IVDKASELGYSDAHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNG
TALTQAEVTELAKYAKEKGIGLIPAINSPGHMDAMLVAMEKLGIANPQANFDKVSKTTMD
LENQEALNFTKALIGKYMDYFADKSKIFNYGTDEYANDATNAQGWYYLKWYGLYNKFADY
SNSLAAMAKERGLQPMAFNDGFYYEDKDDAEFDKDVLISYWSKGWWGYNLASPQYLASKG
YKFLNTNGDWYYVLGNHKQDEAYPLSKAIENSGKVPFNQLASTKYPEVDLPTVGSMLAIW
ADKPSAEYKEEEIFELMAAFADHNKDYFRANYNALREELAKIPTNLDGYSTESLAALKAA
KDGLNLNLNRSKQAELDALVGKLKAALQGLKPSATHSGSLDENELAANVETKPELVVKTE
SIPFKVIRKENPNLPAGQEKVVKAGVLGERTSYVSVLTENGKASETVLDSQVTKEPVDQI
VEFGAPITHVGDENGLAPIAEEKPRLDIPKEEPSRTETPFKVVVESGPKAESNSANGITH
QLADGKNSKPGWKLIESKWYYYDHADKVKTGWVKDGAWYYLDESGVMKTGWQKVNGTWYY
LDNSGAMQTGWIDQGGSWYYLNDSGAMQTGWVNQGDTWYYLDNSGTMKTGWFQVEDKWYY
SYPSGALAVNTTIDGYAVNADGEWIQ

Enzyme Prediction     

EC	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	199	548	1.2e-54	0.9287833827893175
GH20	644	982	2e-50	0.9287833827893175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3525	Chb	0.0	189	976	6	732	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06564	GH20_DspB_LnbB-like	1.06e-102	195	553	1	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	1.44e-102	640	987	1	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
NF033840	PspC_relate_1	3.84e-58	1071	1346	397	648	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
COG5263	COG5263	2.83e-53	1211	1345	174	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBP08867.1	0.0	1	1171	1	1167
AMH87889.1	0.0	1	1209	1	1196
AEL09610.1	0.0	1	1188	1	1171
QQQ35402.1	0.0	1	1188	1	1178
AVD74108.1	0.0	1	1188	1	1174

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RPM_A	3.72e-287	186	651	2	467	Crystalstructure of the first GH20 domain of a novel Beta-N-acetyl-hexosaminidase StrH from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6],3RPM_B Crystal structure of the first GH20 domain of a novel Beta-N-acetyl-hexosaminidase StrH from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
2YL6_A	4.08e-279	190	623	1	434	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],4AZ5_A Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YLL_A	8.66e-279	190	623	21	454	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4]
2YL8_A	1.15e-278	190	623	1	434	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4]
4AZ6_A	3.38e-278	188	622	1	435	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	0.0	1	1172	1	1163	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
B2UPR7	1.87e-08	201	528	239	538	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
B2UP57	4.47e-06	201	436	118	343	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001024	0.997904	0.000414	0.000238	0.000204	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003392_01486.