CAZyme Information: MGYG000003383_02279

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_02279
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896	MGYG000003383_29|CGC5	100774.65	4.6746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 202966; End: 205656 Strand: -

Full Sequence      

MIPDDMTFLTLDSGWTLTADNPESAPEELRKRLTNGIPATVPGEASVDLLRAGLIADPFD
ADNEASTLWVGDVDWRYECRFDWHDNGRSRHDLVALGVDTLASVVLNGRRVDAVGNAFLA
YRWDVRNLLVEGENILVVQFTSPVRASDELEHRRGYYPHAERFAFNQIRKPAYGFGWDWG
IAVPGSGLWRPIRIESWSVARVHEVRPLARVDDQGRGVLQVFGTVEREGAGRVRDMLHPH
GGDHDITLSVTVTRGDLSLSRNVAVPSDRSAFDVEITVEHPELWWPAGYGEHPLYDVDVT
PVNGDGTPVFGGIGWHGRIGFRTITADTAIDSVGRPFRLVVNGQPIHARGYNWIPASAFV
SQVTDGDYRRLMRDVAESNSNMLRVWGGGIYESDTLYDLADEQGILIWQDFMFACAMYPQ
EPDMVAQVEAEAREQIIRLSPHASLAVWNGSNENYVAYAQWDEYRSGLRDDDREPDRYGG
REKPWGDLYYDTIIPGLLERLDPTRIYLPSSPMSFNKHAAQSSDVDGTIHIWDVWNSADY
RKYADYTPRFADEFGYQGPPAFSTLTRVVHDVPMDPFSPQMLAHQKAVLGNIKIARGMRS
HLTPGSFDDMTPDEQGWRRWLIDTDQWNDIEDWHWAAQLQQAQAVRFAVEHMRSLEPVND
GILIWQINDDWPVISWAAVDYDGHRKPLWYVSRQTFAPRFATIRPGVSASRRATAWPGIV
PGPDRLILHVINDGMADYDTEWTVRRMKLDGSVLAETTMRCLVSAHQSAHLELPGEIADF
GDAADEIIVAETSEGFSRAVYNPVDVIGQRLCADAFDARVESGEQGYLLHVTARSYVRDL
FCMADKVHPEAGVNDGMVDLLPGESLVWRIDSPKVDEPSLFAAGNVLRSANDLRHL

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	780	7.7e-80	0.699468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.20e-55	5	734	9	661	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.58e-04	200	322	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	0.003	724	791	1	70	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHJ18886.1	0.0	7	895	11	895
AUD82655.1	0.0	7	895	11	895
QOL35164.1	0.0	7	894	12	903
AEF27548.1	0.0	7	894	11	894
QGM61607.1	0.0	7	894	7	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	6.03e-117	6	872	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.17e-117	6	872	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	4.26e-116	6	872	1	832	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	4.37e-116	6	872	3	834	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.07e-107	4	698	4	653	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	3.13e-83	11	880	9	836	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q29444	8.08e-83	37	698	40	690	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	2.12e-82	37	698	40	690	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q0CCA0	5.38e-81	39	704	30	659	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	2.73e-80	11	704	9	661	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003383_02279.