CAZyme Information: MGYG000003380_01810

Basic Information

• Species: Corynebacterium aurimucosum_E
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium aurimucosum_E
• CAZyme ID: MGYG000003380_01810
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	MGYG000003380_37|CGC1	27131.18	4.678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003380	2319588	MAG	United States	North America

• Gene Location: Start: 6236; End: 6997 Strand: -

Full Sequence      

MKRLLQIFGGCGVAVAVIIALVAWLLTGHGTSQKPVPENIPPVEGKEVARIDVNAPGRTA
DKLTYWASDLAEQTGIPPAALRAYGNAELIAQQKWPNCHLRWNTLAGLGYVETRHGTYNG
NWFKPSKLDDAGYPQPPINGIALDGLNNTAHTPDTDNGDIDGDSKYDRAVGPMQFIPTTW
ESVGADANGDGKADPNQIDDAAVGAAGLLCFGDRDLSNPEQWEEAVLNYNQSSEYLHKVA
HAANAYSVPQSAK

Enzyme Prediction     

No EC number prediction in MGYG000003380_01810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	246	5.1e-17	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	5.45e-24	74	234	106	261	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	2.56e-19	98	245	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	2.29e-04	156	206	139	193	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA99673.1	1.15e-189	1	253	1	253
QRQ66899.1	6.68e-189	1	253	1	253
QQU81407.1	3.86e-188	1	253	1	253
QQN47192.1	1.02e-183	1	253	1	253
VEH72554.1	2.34e-148	1	253	1	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000002	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26