CAZyme Information: MGYG000003377_03570

Basic Information

• Species: Phytobacter sp002377245
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter sp002377245
• CAZyme ID: MGYG000003377_03570
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000003377_90|CGC4	24745.72	10.0758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003377	5122475	MAG	United States	North America

• Gene Location: Start: 132186; End: 132857 Strand: +

Full Sequence      

MPLTLFVVIRRDAFTIEGLRVKLRWFAFLVVLLAGCSSKQDYRNPDWNPEVPVKRAMQWM
PISQKAGAAWGVSPRLITAMIAVESGGNPTLVSKSNAVGLMQLKASTAGREVYQRMGWKG
EPTTSELKNPERNISMGAAYLSILEHGPLAGIKNPEVMQYALVVSYVNGAGALLRTFSSD
RKKAINEINDLSANEFFEHIVDNHPAPQAPRYIWKVQKAMDAM

Enzyme Prediction     

No EC number prediction in MGYG000003377_03570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	221	3.2e-16	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	2.15e-153	21	223	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	3.75e-82	61	220	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.58e-54	54	219	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	1.78e-28	63	188	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.25e-27	19	221	91	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE78379.1	4.58e-145	1	223	1	224
SKC21376.1	3.03e-134	1	223	1	224
QOV62239.1	1.18e-133	21	223	1	203
ANR77071.1	2.30e-133	16	223	4	212
QJF18265.1	2.46e-133	21	223	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	8.76e-112	37	223	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	2.78e-111	37	223	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	2.13e-110	39	223	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	6.11e-110	39	223	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	6.11e-110	39	223	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5PN08	3.20e-132	21	223	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1
B5R2X1	3.20e-132	21	223	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5R901	3.20e-132	21	223	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
B5BI54	3.20e-132	21	223	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=emtA PE=3 SV=1
Q57NL3	3.20e-132	21	223	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002765	0.098172	0.898848	0.000185	0.000035	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003377_03570.