CAZyme Information: MGYG000003377_01435

Basic Information

• Species: Phytobacter sp002377245
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter sp002377245
• CAZyme ID: MGYG000003377_01435
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	MGYG000003377_37|CGC2	75100.07	8.9842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003377	5122475	MAG	United States	North America

• Gene Location: Start: 54451; End: 56484 Strand: +

Full Sequence      

MSSVLGIFSGGIWRIPYLGSFLPGERVRLSTLKAIPENVSAVAVWGYRPSAEKPAALAKA
AGVPVVRLEDGFIRSLGLGVQGCPPLSMVIDHLGMYYDASTPSTLEQLIQDSAGNQAFSD
EAKAMMRAIVDEDLSKYNQAPPFVAPEPMPNAVLVVDQTFGDVSVTKGNASADCFQQMLE
AAKRENPHAEVWVKVHPDVLCGKKSGYFTSIKNDPRVRWFAEDVSPQSLLRHMQKVYVVT
SQYGFEALMAGKPVVTFGQPWYAGWGLTDDRHPQADALAARRLHASLVDLFTAAYLRYTQ
YRHPITGEPASLGCVVDWLSLQRRHTLARPGTLWAPGLSLWKTAILKPYLKTSTNEVRFA
RQCPHATTLIAWGTRGEAKWQAQANAQGINLWRMEDGFIRSSGLGSDLLAPLSLVLDKSG
IYYDATRPSDLENLLNASQLSERQIARASALRLQLVRNKVSKYNLGLDWQLPAEAAGKKV
ILVPGQVEDDASIATGALSINTNSDLLRTVRERNPDAFIVFKPHPDVLVGNRKGQIPAED
AARWADCQALDADIIQCIQHADELHTMTSLSGFEALMHGKKVFCYGMPFYAGWGLTQDEH
TLSRRHRQLSLDDLVWQTLIAYPTYIHPQRLTPMSAEEAAQWLSSAPRGEMKITKKNIGR
LARQYRKLKMFYKVRFG

Enzyme Prediction     

No EC number prediction in MGYG000003377_01435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	281	669	6.1e-145	0.7368421052631579
GT107	12	319	4.8e-101	0.5827067669172933

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	7	675	6	664	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	4.23e-161	368	625	2	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.15e-144	42	304	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	5.27e-125	369	625	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.53e-108	42	301	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUV32495.1	0.0	1	677	1	677
QLK39940.1	0.0	1	677	1	677
QOV71379.1	0.0	4	677	1	674
AUV04097.1	0.0	4	677	1	674
AUU92844.1	0.0	4	677	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.84e-154	5	356	3	355	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	3.23e-72	5	319	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	1.48e-71	339	639	10	314	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	0.0	4	677	1	675	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	5.75e-203	9	673	28	701	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	2.63e-201	9	673	28	701	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	3.70e-56	337	625	80	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003377_01435.