CAZyme Information: MGYG000003371.1_01289

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas
• CAZyme ID: MGYG000003371.1_01289
• CAZy Family: GT51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000003371.1_589|CGC1	38921.16	10.0009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003371.1	3702384	MAG	United States	North America

• Gene Location: Start: 4; End: 1092 Strand: +

Full Sequence      

MNLPTGGGLYIPQNYDHRYAGWVSLRAALGSSLNVPAVRTLAMVTPHRFHQRLVALGLPL
TQSGDYYGYSLALGSADVSLLSLTNAYRSFANQGAYAPSRMTQNAAVPSKQNVMMPAATF
VIGDVLSDRHARARTFGLDSPLTTRFWTAVKTGTSKDMRDNWCVGWSERYTVGVWVGNAS
GASMHDVSGVSGAAPVWHEVMEALHQRTPSRAPAMPSGVERVALTFDDELEPARQEVFLS
GTAMRRVSVGTTEQGNTMPAIASPADGTIFALDPDIPPAAQRIWFHADGLTGQTARAVSW
RMDGKPLGKGGQVAWLPWPGRHRVQLVDAAGKVVHEIGIEVRGAGVRETAAPRKTPAGPV
RQ

Enzyme Prediction     

No EC number prediction in MGYG000003371.1_01289.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	1.55e-86	3	334	341	720	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.18e-48	3	343	362	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.71e-37	5	206	324	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.15e-31	2	281	390	658	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.91e-30	6	269	492	794	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP11485.1	2.85e-262	1	362	374	735
AVA37479.1	2.85e-262	1	362	374	735
QWC90340.1	2.85e-262	1	362	374	735
ABF10401.1	9.78e-261	1	362	365	726
QGS30895.1	1.33e-260	1	362	374	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	6.28e-08	12	242	546	805	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	2.80e-07	5	203	245	459	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.69e-06	5	193	245	447	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2JCH_A	4.36e-06	2	210	157	382	Structuraland mechanistic basis of penicillin binding protein inhibition by lactivicins [Streptococcus pneumoniae R6]
2BG1_A	4.53e-06	2	210	188	413	Activesite restructuring regulates ligand recognition in classA Penicillin-binding proteins (PBPs) [Streptococcus pneumoniae R6],2XD5_A Structural insights into the catalytic mechanism and the role of Streptococcus pneumoniae PBP1b [Streptococcus pneumoniae R6],2XD5_B Structural insights into the catalytic mechanism and the role of Streptococcus pneumoniae PBP1b [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	4.98e-20	1	208	365	568	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
A7GHV1	4.78e-15	5	219	435	658	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	4.79e-15	5	219	435	658	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	4.79e-15	5	219	435	658	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
O66874	6.03e-15	4	242	463	710	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003371.1_01289.