CAZyme Information: MGYG000003367_02339

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_02339
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	MGYG000003367_62|CGC1	48846.57	7.2941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 32837; End: 34174 Strand: +

Full Sequence      

MRKNFFIAGLVILLSSGLQAQQLAFPGAEGYGKYTSGGRGGVVFTVRNLNDSGAGSLREA
VEAQGARTIVFAVDGTIELKSPLRINNDSITIAGQSAPGEGICLKDYPMVVNANNVIVRY
IRVRVGDHHHIDSDGIGGGRYGQKNVILDHLTSSWSIDECLSIYKTENLTVQWCLVTHSL
NNSVHTKGKHGFGGIWGGYKATFHHNMLANNSSRNPRFASVDGTKWVDYRNNVIYNWGFK
SAYGGGHHGEINIVDNYYKPGPASEHHRLLDVAEDGTGRYFISGNVMVGDKKVTEDNRHA
IGEFHAVASSDSSHKSLNPEDYLVDKPFPFEAINEDSPVVAYHRVLKSVGCSFSRDSYDR
EVIRQVRKGIGTFGKNGIINSQEDVGGWPVLKKGKALQDTDGDGMPDSWEKKHHLNPQDP
SDGSIFGLSKDYTNVEVYLNSLVKF

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	75	258	6.1e-74	0.9890710382513661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	5.34e-07	4	288	7	307	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	1.16e-04	74	258	1	186	Amb_all domain.
pfam18884	TSP3_bac	6.29e-04	399	420	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59319.1	6.35e-243	1	444	1	458
ADY37134.1	1.63e-215	6	444	4	431
QCD40703.1	8.30e-212	16	444	10	454
QCP73753.1	8.30e-212	16	444	10	454
ADY54248.1	1.51e-179	3	443	11	442

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	8.93e-54	23	443	21	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.75e-53	23	443	21	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
B0XMA2	3.65e-52	8	443	5	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	5.10e-52	23	443	22	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
A1DPF0	7.12e-52	8	443	5	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000347	0.998252	0.000835	0.000196	0.000187	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_02339.