CAZyme Information: MGYG000003367_00706

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00706
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000003367_19|CGC4	36356.49	7.7111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 107677; End: 108642 Strand: +

Full Sequence      

MKKISRCLFSLFIIQCLCTASLYGANWKDTIVVARDGTGDYRTLNQAMEGIRAFMDYKVT
VLIKNGVYKEKLVIPSWLQNVEFIGEDSARTIITYDDHANIDKMGTFRTYTVKVEGNDLT
FRNLTIENNAAQLGQAVALHTEGDRLRFIGCRFSGNQDTIYTGVKGTRLCFFDCYIEGTT
DFIFGPSTALFEQCIIHSKRNSYITAASTPQDIEVGYVFKDCKLTAESGVDKVYLGRPWR
PYAATVFINCEMGKHICPAGWDNWKNAENEKTVRYAEYGSIGEGASPGRVKWAKQLSQME
AERYGNLEYIFKMCSNWLPAR

Enzyme Prediction     

No EC number prediction in MGYG000003367_00706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	309	1.3e-98	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	8.31e-72	33	304	9	290	pectinesterase
pfam01095	Pectinesterase	4.00e-68	31	304	2	289	Pectinesterase.
COG4677	PemB	2.47e-64	31	306	84	398	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	6.87e-64	31	301	13	277	putative pectinesterase
PLN02682	PLN02682	8.93e-63	30	319	70	368	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69178.1	4.34e-178	27	321	27	322
QRQ48638.1	6.04e-167	3	317	2	319
QUT45769.1	7.42e-167	12	317	7	315
ALJ61263.1	7.59e-165	25	319	25	320
QUT93208.1	7.59e-165	25	319	25	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.59e-43	31	320	9	310	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	8.70e-39	32	292	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	5.24e-34	31	297	11	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.79e-33	31	297	11	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.66e-27	61	319	37	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.92e-54	33	310	9	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.14e-51	26	311	77	373	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P41510	3.11e-48	24	318	266	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	4.98e-48	24	318	253	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8GXA1	1.28e-47	28	319	255	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001207	0.950033	0.047938	0.000271	0.000254	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_00706.