CAZyme Information: MGYG000003358_00725

Basic Information

• Species: Kluyvera ascorbata
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata
• CAZyme ID: MGYG000003358_00725
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000003358_20|CGC1	62205.85	9.8573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003358	4968008	MAG	United States	North America

• Gene Location: Start: 50246; End: 51901 Strand: +

Full Sequence      

MKSLRYGISLVALFVLYYLLPLNFRLLWQPDETRYAEISREMLATGDWIVPHFLGLRYFE
KPIAGYWINSIGQWLFGHNNFGVRFGAVFSITVSALLVAWLAWRIWRDKKVALLSGVIFL
TAFLVYGIGTYAVLDPMITLWMTLAMFSFWLAASAKTTGERFWGYVLLGIACGMGVMTKG
FLALAVPVIAVLPWVIVQKRWREVLIWGWLAVLVCVLTVLPWGLAIAQREGDFWRYFFWV
EHIQRFAQSDAQHKAPFWYYLPFLIAGSLPWLALLPGALKLGWRGREGQSSAFYLLGWIV
MPFLFFSIAKGKLPTYILPCFAPLAMLMARYAVDAAKVGAKALRINGIINIAFGVIGLVA
VFVVSPWGPMKQPVWMQIELYKCVLAAVAFFVWALMGWLSIKSDAQRWTLAALCPLGLAL
LVGFAIPDRVTNSKQPQFLVDIVSESLTPSRYVLSNSVGIAAGLAWELNRSDIIMYAQTG
ELKYGLAYPDAKGRFISDSDFPQWLEAHRQEGPISLVLQLPRNAKVVDLPLPKPDEVYVM
GRTAFIQYRPQ

Enzyme Prediction     

No EC number prediction in MGYG000003358_00725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	520	2.4e-157	0.9592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	550	2	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	9.66e-101	1	520	3	531	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	4.07e-42	3	237	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	3.18e-09	61	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	2.41e-04	1	179	18	209	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV63887.1	0.0	1	551	1	551
QGH37385.1	0.0	1	551	1	551
QGH28403.1	0.0	1	551	1	551
VDZ85943.1	0.0	1	551	1	551
QIR25605.1	0.0	1	551	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.74e-34	11	485	38	513	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5XTL1	2.02e-316	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
A6TF96	4.06e-316	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1
B7N5M2	1.06e-259	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1
B1LLL1	6.08e-259	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=arnT PE=3 SV=1
B7UFR9	3.50e-258	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000005	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	29
81	103
112	134
138	155
162	176
180	197
204	226
257	279
292	309
314	333
346	368
383	401
408	427