CAZyme Information: MGYG000003358_00424

Basic Information

• Species: Kluyvera ascorbata
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata
• CAZyme ID: MGYG000003358_00424
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		64779.31	5.0367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003358	4968008	MAG	United States	North America

• Gene Location: Start: 8799; End: 10610 Strand: -

Full Sequence      

MSNVFDFELVANDQVSDVIDRINEAIRGLEPKLDKTKEGLQLGGQETVDGLNGFISRFEN
LSKSARDNVQFIGDMVPPLKMVGELSGELGSLGIVGAAGYGLKQVAYGFREASREAYNLD
VSSKNAGMRVDDYSRLAGAMRILGADSESANASIDGMAKTLKEAASGANGQVLGALAQIG
VQIQKNNDGSVDTLKTLQEIARVFPTLRPEQQKSVADALGLTPEMLALMREGERMKSLLA
KSDEFGLTIDPELNQQLGDINGTMNELSASWDGLWQRSKNKSLTALLSDGSVKDGLEGVT
DLFTNGDFTGLSHALGFVSSDNAKKLRRIQGDKELYNSLSRRERGAVDGGFYTDAVSKRY
DAKYRPGDLAEQLNSDLAAINRPGIGGNNNVPYNQGGQYDSIFSSAGKQWNVDPRLLKAI
MKQESSGNPYAVSSADARGLMQIMPSNFKATGVTDWTDPQQNIMAGAQILSENLQRSGGN
VPLALRYYNGGYDTRRWGRQNQAYPGAVLAHYQSIINSESKNDGGISDAGIYPPSTGGAD
GGGSIITAKNSGNGQMADNLARSLKEAMSDQKVKLEITLVNDKGEKKSYNVGNNGRITTP
MNY

Enzyme Prediction     

No EC number prediction in MGYG000003358_00424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	412	521	1.1e-27	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.58e-32	414	513	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.66e-29	406	509	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	3.99e-24	399	491	5	105	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.24e-24	399	497	6	114	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	3.11e-23	393	522	133	271	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR20149.1	0.0	1	603	1	603
ATF49842.1	0.0	1	603	1	604
BCT15438.1	0.0	1	603	1	604
ALR75843.1	0.0	1	603	1	601
AKR78001.1	0.0	1	603	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GI4_B	1.37e-09	388	487	11	123	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	3.41e-09	388	487	11	123	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHZ_A	3.41e-09	388	487	11	123	Structureof Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12],6GHZ_B Structure of Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12]
3T36_A	3.94e-09	388	487	28	140	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	8.45e-09	388	487	11	123	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	1.01e-23	398	535	6	140	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	3.17e-19	397	522	1420	1551	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.17e-19	397	522	1420	1551	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	7.22e-18	400	491	61	152	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B5XQ85	1.26e-10	388	487	28	140	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003358_00424.