CAZyme Information: MGYG000003351_02253

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_02253
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1005		111632.03	9.6452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 6336; End: 9353 Strand: -

Full Sequence      

MKIIPSILAILFLLSAGQVTSLAQNVITPTVEPLLVSKALQDEDCRHWVDSVMNKLSFKE
KVGQLFIYTIAPIDTKRNLELLREAVDTYKVGGLLFSGGKMQTQVDLTNRAQKLAKVPVM
ITFDGEWGLAMRLRGTPVFPRNMVLGCIRDNQLIYEYGREVARQCRQIGVQVNFAPVADV
NINPKNPVINTRSFGEDPIQVADKVIAYAYGLEGGGVLSVCKHFPGHGDTDVDSHKALPV
LPFTRERLDSVELYPFKRAIRAGLGGMMVGHLQVPVIEPIGGVPSSLSRNVVSGLLTDEL
AFKGLIFTDALAMKGVAGSGNVSLQALKAGNDMVLAPRNLKDEVPAVLEAVEKGELSKED
IENKCRKVLTYKYVLGLKKKPFIQLSGLEQRVNSPQARDLVRRLNQAAITVLNNKNHILP
LHADKAQTIALLEVGKPGETEALAKQMSRYVSLARFRLRPNQTEEENRRLRDSLATYKRI
IIAVSEQRLAPYQPFFAKFAPESPAIYLFFTPGKMMLQIHRSVSHASAVVLGHSHNSDVQ
RQTADILFAKATADGRLSASLGGLFPTGAGVTITPKTPSHFVPEEYGLSSALLKKIDTIA
LDGIQQGAYPGCQVVVLKNGHVMVDKAFGTYAGKGSPRVESTDIYDLASLSKTTGTLLAL
MKLYDKGRFSLTDKISDYLPFLQRTDKKDITIQEILYHQSGLPSWLPFYQEVIDKDSYDG
RLFSVRKDAQHPVRIGATTWANPKFKFKSEYISPVKKGDYTIQICDNLWLNRSFRKVIEE
KIVEAPLKQKRYVYSDIGFILLGMLVEQLAGMPMEAYLQREFYGPMGLERTGYLPLRRFS
KSEIVPSNKDRFLRKETLQGFVHDEASSFFGGLAGNAGLFSTAREVAHVYQMLLNGGEID
GQRYLSKETCQLFTTGVSKISRRGLGFDKPDMEDPRKGNCASVVPAGTYGHTGFTGTCAW
VDPVNELVYVFLSNRIYPDVTNRKLNQLHIREQIQEAIYGAMKKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	335	7.3e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.17e-76	59	432	4	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.40e-73	60	370	4	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	5.84e-58	583	1003	30	432	putative periplasmic esterase; Provisional
COG1680	AmpC	2.24e-46	558	979	1	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].
pfam00144	Beta-lactamase	3.75e-41	596	988	1	321	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU92871.1	0.0	1	1005	1	1005
QUT79868.1	0.0	1	1005	1	1003
QGT72105.1	0.0	1	1005	1	1003
QDM09839.1	0.0	1	1005	1	1003
ALJ47263.1	0.0	1	1005	1	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	5.95e-61	50	467	36	490	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.72e-60	50	467	10	464	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.08e-60	50	467	40	494	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	7.36e-60	56	415	11	379	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	4.85e-48	91	361	58	335	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	3.26e-60	50	467	36	490	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	9.47e-44	82	432	55	435	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B5RCU8	7.15e-42	583	1000	30	421	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=yfeW PE=3 SV=1
B5BB26	9.68e-42	583	1000	30	421	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=yfeW PE=3 SV=1
Q5PCQ2	9.68e-42	583	1000	30	421	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002296	0.996475	0.000297	0.000339	0.000284	0.000283

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003351_02253.