CAZyme Information: MGYG000003343_00688

Basic Information

• Species: Veillonella_A sp900765165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A sp900765165
• CAZyme ID: MGYG000003343_00688
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		64266.58	9.3496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003343	2478402	MAG	China	Asia

• Gene Location: Start: 1301; End: 2989 Strand: -

Full Sequence      

MTTDTELQQEPTTVTGSNEAKKRDLTALWLGLGTIIIYLLFTWLLPVTDPVESNYALTAR
EMVLRGDYMTPYIYGHPWFDKPIWTYWMLIGAYNLFGFTDFASRLPGVIAGGVSVSLMYY
GVKRLFEDRKFAISASVIMGTFFEFWYITHAVITDQYLFLFSMGTFFYAYFGLRDKKVKD
LCLAYAFAGLAVLDKGPVGLVLPGMLLIVFLLVMKEWRKLLFLFHPLGLIVFAVIALPWY
LYMYSLHGWGFMDAFLGLHNYVRATISEHPRFNVWYYYIVIWILSLLPWNALVVYGLRYA
KRDSRYIYSLVWALGVILFYSCMATKYSTYTYISLIPFGIFGALGLQQWQLRHEGKTVAR
WKSVAMIGGPALFLIIAVVGAGMVYLPSAGIVLILTLIAVVALLWWSYRKERSAYSWQRY
TTAAVLVFFTVIASLLGPIMSNQSGKALAEAVPVNETSQVYFYKKFSASYVYYSGHIASL
LRDTNKPATNIWTVGKEVMPLATPAEMLKEMDKLPPVTTEEWKHPSVYIFVQKNDVAEFE
KSHMYKDVRAYAVVGDTHVYVR

Enzyme Prediction     

No EC number prediction in MGYG000003343_00688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	21	488	4.7e-89	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.20e-41	18	408	1	399	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.18e-25	24	407	1	396	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.11e-16	80	239	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.68e-07	34	244	14	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU37212.1	1.25e-108	35	561	15	535
ARG00055.1	1.36e-108	35	561	15	535
BBK24579.1	1.37e-108	42	547	44	535
CAB1277318.1	5.08e-108	35	561	15	535
SNV75245.1	1.01e-107	35	561	15	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.17e-23	47	368	54	386	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02R27	1.30e-24	43	368	18	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q6D2F3	2.41e-24	30	432	6	424	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	1.38e-23	30	432	6	424	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
Q9HY61	1.78e-23	43	368	18	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
B7VBN0	1.78e-23	43	368	18	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000052	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47
83	98
105	122
132	149
156	173
196	213
220	242
275	297
306	325
329	351
363	385
389	408
420	439