CAZyme Information: MGYG000003338_00283

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas
• CAZyme ID: MGYG000003338_00283
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		43051.53	7.1345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003338	3210940	MAG	United States	North America

• Gene Location: Start: 284; End: 1387 Strand: +

Full Sequence      

MNKKLFALLLILPFQLLFCQKDMLTNFPSGSKPEEVGKRLAYHFVDDRHDLYFAKYIHYA
EVCTWNGALSFAKENKDKKLLKQLQDRFEPFFSREKALLPPMNHVDYNMFGSLALQLYQL
TNDNRYRDMGMAYADTQWQVPADAKAEEKAWADKGHSWQTRLWIDDMYMITVVQMEAYKV
TGDKKYMDRAAEEMVLYLDEIQRPNGLFYHAPDVPYYWARGDGWMAVGMADLLRYLPEDH
KNRPRIMKGYLTMMESLKKYQRPSGMWNQLIDEPDCWVETSGSAMFTYAFIVGVKKGWLD
ANEYAPAARKAWLAMIPYIDERNNVTEVCIGTGKKNDKQYYYDRPRLAGDFHGQAPYLWC
VVALMEK

Enzyme Prediction     

No EC number prediction in MGYG000003338_00283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	364	4.9e-75	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.73e-52	64	360	34	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.55e-44	58	367	35	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL47865.1	9.50e-219	1	367	1	368
QEK99564.1	2.58e-217	3	367	5	369
QEH44090.1	2.09e-210	5	366	6	366
QPH41801.1	5.10e-209	2	367	3	367
QDO68157.1	1.31e-202	1	367	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.45e-34	64	359	87	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.58e-27	58	364	40	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.10e-26	58	364	30	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	5.46e-23	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4WU0_A	1.05e-22	64	358	30	352	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.41e-26	58	364	40	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	3.67e-16	147	315	141	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	9.89e-15	217	315	231	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	4.09e-12	99	345	68	316	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	6.43e-09	174	356	6	220	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999092	0.000215	0.000140	0.000139	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003338_00283.