CAZyme Information: MGYG000003324_00821

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; VUNA01
• CAZyme ID: MGYG000003324_00821
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28662.13	7.0551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003324	2171467	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 13; End: 768 Strand: +

Full Sequence      

MLLFRESAKGHSGEYLQKHHVISVIVPVYNEVALVQPFVKNLEWLEGRCEIIFVDGGSSD
GTRAVLREAEAESGGKIRFLESSKGRGMQMNIGAEAANGDILFFLHIDAELPEHPVEEIL
SVMEKVDAGCFGIRFRSRNFFMWTNKVISNRRAAKGIIFGDQGLFIKREVFYEAGMFPEI
PIMEDYQFALTLREMGVATAMTENTLLVSDRRYRGSTIRKLMVMKHMANLRKRYRAGEDP
VKLFEEYPDIR

Enzyme Prediction     

No EC number prediction in MGYG000003324_00821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	23	147	5.7e-21	0.7470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	1.10e-77	22	247	1	220	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
cd02522	GT_2_like_a	1.85e-61	22	247	1	221	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	7.89e-21	22	221	2	216	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam00535	Glycos_transf_2	8.01e-21	23	177	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04179	DPM_DPG-synthase_like	1.99e-17	24	144	1	126	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49539.1	2.70e-74	22	251	3	226
CBK78105.1	4.63e-71	9	251	208	444
SET56509.1	1.33e-70	1	251	201	445
QIX90246.1	3.56e-70	12	251	210	443
ANU45437.1	7.08e-70	12	251	210	443

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY7	1.42e-09	21	167	8	163	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnC PE=3 SV=1
A4SQW8	3.48e-09	21	167	8	163	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnC PE=3 SV=1
D4GYG7	1.94e-08	22	178	8	176	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
B4ETL6	3.84e-08	17	167	5	164	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnC PE=3 SV=1
C3KAD3	5.42e-08	20	167	7	163	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003324_00821.