CAZyme Information: MGYG000003317_00359

Basic Information

• Species: Lentilactobacillus buchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus buchneri
• CAZyme ID: MGYG000003317_00359
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000003317_31|CGC2	77936.88	6.6291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003317	2478253	MAG	Russia	Europe

• Gene Location: Start: 9204; End: 11228 Strand: +

Full Sequence      

MRAILSGVHQKKGKQVLEFELLDVAVSLDTAYVLFVEKNSLASIMKPISKVLSHNIIRVN
IDAQDFHFQSEDQTEFEWQIFLINNNLTNKNVIQVESEYLSDRHQLELTSYYQFNSDAQG
MALFNIRTHQSDEEFMINSVNLTDENLEITGYNKINGTLIKNQRIILKNHTTEGTLEYPV
TKKLFEGMFTVAIPLTDIPQNSVGELFIEYELNGKSIKQRLIISKSLAGQSTDIQLAGNR
EITLEKRYDNGILVKEFAGASLLQKVGAAGGKAGTIIDVIKMIQDKLNLVRMRFLFKSGH
SPYDNTTIIFESFGGRQVSDSPYAIYKVFKTLYPGINMIWSIDRSQKKFCKENQIAYVIR
RTNKWVRVLEKSQFWISNARFPTWVKKPNYVTYIQTWHGTPLKKLGLDIENVSMPGTTTV
KYHKNFVREANRWDALVSPNDYSTQIFRSAFGFNNQILKIGYPRNDELINTQPEDIDAIK
EQLGIPLDKKVVMYAPTYRDNQFAEKGKYTFELPFDLDDFRKSFGDDTVLILRMHYLISN
ALDISDYSDFVYDYSNYPNISDLYLVSDLLITDYSSVFFDYAYLKRPILFYPYDYHLYKE
ELRGFYLNYEKDLPGKIAENSKQLLAEINHALAHPDMSANEKFMNFYNRFCAINDGLSSL
KVVNYVMHQIESGM

Enzyme Prediction     

No EC number prediction in MGYG000003317_00359.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.02e-134	302	666	1	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.23e-89	281	667	1	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB03791.1	4.66e-113	291	671	338	719
AUJ51934.1	4.66e-113	291	671	338	719
AVP36241.1	4.66e-113	291	671	338	719
QOV86652.1	6.54e-113	291	671	338	719
QTN00810.1	7.19e-113	287	669	364	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.14e-113	307	671	354	719	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.30e-112	307	671	354	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	6.35e-112	307	671	354	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	4.22e-123	124	666	161	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	2.48e-113	299	667	25	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	9.54e-113	307	671	354	719	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	3.51e-108	308	662	30	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	6.11e-36	336	671	57	381	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003317_00359.